SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009538 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009538
Domain Number 1 Region: 606-910
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.99e-71
Family WD40-repeat 0.00019
Further Details:      
 
Domain Number 2 Region: 957-1239
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.49e-61
Family WD40-repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 106-384
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.39e-43
Family RecA protein-like (ATPase-domain) 0.085
Further Details:      
 
Domain Number 4 Region: 1-92
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-20
Family Caspase recruitment domain, CARD 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009538   Gene: ENSMODG00000007679   Transcript: ENSMODT00000009726
Sequence length 1251
Comment pep:novel chromosome:BROADO5:8:76136760:76220702:1 gene:ENSMODG00000007679 transcript:ENSMODT00000009726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAKARNCLLQHKEALERDIKTSYLMDHMISDQVLSLSEEEKIRNEPTQKKRAALLITVL
LGKDNNSYISFYNALLHEGYKDLAFLLQKGLPLSSYNGKDPVDGVTSYVKTVLCEGGVPQ
RPVVFVTRKKLVKSIQEKLYKLNDEPGWVTVYGMAGCGKSVLAAEAVRDHNLLKTCFPEG
VHWVSVGQQDKSGLLMKLQNLCTRLDQDGAFSQRLPLNLEEAKDRLRFLMLRKYPRSLLI
LDDIWDSWVLKAFDSHHQILLTSRDKSVTDAMMGPKYAVPVESGLRKEKGLEILALFVNM
KKTDLPEQAHSIVKECKGSPLVVSLIGALLHDFPNRWGYYLRQLQNKQFKRIRKSSSYDY
EALDEAMSISVERLSEDLQKYYKDLSILQKDVRVPTKVLCILWDMETEEVEDILQEFINK
SLLFYDRNGKSFRYYLHDLQVDFLMEKNRDQLKELHRKVVTQFQRYCQAHSLPSDQEDSM
YWYNFLAYHMASADMRQELCNLMFSLDWIKAKTELVGPAHLIHEFMRYRHLLDKKDCTIC
ENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYRQAKLRAKQEVDKGKLYLEWINKK
TIKKLSRLVVRPHTDAVYHACFSKDGQRIASCGADKTLQVLQAETGERLLEVEAHEDEVL
CCAFSKDGLFIATCSADRKVKIWNSRTGELVHTYDEHTEQVNCCHFTNMEHHLLLATGSS
DCFLKLWDLNKQECRNTLFGHMNSVNHCQFSPDDTHLASCSADGTLKLWDVSSANECSSI
DVKQHFLTGDGRQDDVDVVVKCCSWSNDGARLMAAAANRLLVFDVQSRNLLGEIHTSHSS
TIRFCDFFPKSHLAAVALSHYCVELWNTDTGLKVADCRGHLSWVHCVAFSPDGSSFLTSS
DDQTIRLWETRKVCKNSAIMLKQEVDVAFRDDEVMVLAIDNIRRLQLINGKTGHTDYLTE
AHKSRISCCCLSPGLRFVAFGEEDGSIKILELPNGREFRSRIGHEKAVRRVQFTPDGRTL
ISSSDDSTVQVWNWQSEEFVFLKAHQEPVKDFRLLQNSRLLTWSFDGTVKVWNILTGKVE
KDFTCHQGTVLSCDVSPNATKFSSTSADKTAKIWNFESSFPLHELRGHEGCVRCSVFSGD
NALLATGDDNGEIRIWSVSSGGLLHSCLPLTVEEGEATYGGWVTDLHFSPDGRMLVSAGG
YLKWWDVDTGESLQTFYTNGTNLKTIHVSPSFRAYVTVDNLGILYILQALE
Download sequence
Identical sequences F7FNF3
XP_001364873.1.35504 XP_007503321.1.35504 XP_007503322.1.35504 XP_007503323.1.35504 ENSMODP00000009538 ENSMODP00000009538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]