SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009583 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009583
Domain Number 1 Region: 11-304
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-63
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 437-520
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000024
Family Caspase recruitment domain, CARD 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009583   Gene: ENSMODG00000007716   Transcript: ENSMODT00000009772
Sequence length 540
Comment pep:novel chromosome:BROADO5:3:351639403:351690138:1 gene:ENSMODG00000007716 transcript:ENSMODT00000009772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGDSADSLAISSSLPTIPYHKLADLRFLSRGASGTVSSARHADWRIQVAVKHLHFQTPL
QESDISDILREAKILHKARFSYILPILGICYEPEFLGIVTEYMSSGSLNQLLHRKNDYPD
IAWALRFRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRQMSL
SQSKSSTSNPEGGTIIYMPPENYDHSQNSRASIKHDIYSFAIIMWEVLSRKQPFEEVVNP
LLIMYRVSKGNRPDTDEENLPLDIPHRTQMISLIESGWAQNPDERPSFLKCLIELEPIVR
TFEDITILEAVLQLKKTKNNLKIIPLSSKKTMEYPLNIPVNNGPQEESCRTPLTIHSDPG
IARSITTPQDNFFSSEQNQEHSTLPHFSLNHSWDDNISSVQRAKFCNHKATCSSVHPLTL
EGNSDLPSESQGNDVAQQWIQSKREDIVHQMTEACLNQCLDALLSKDLLMKEDYELISTK
PTRTSKVRQMLDTSDIQGEEFAKIIVQKLKDNKQLGLQPYPEVPIISRITSLNLFQNKSF
Download sequence
Identical sequences F7EUW8
ENSMODP00000009583 ENSMODP00000009583 XP_016287297.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]