SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009608 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009608
Domain Number 1 Region: 842-950
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-25
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 2 Region: 42-168
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 322-441
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000526
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 4 Region: 283-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000183
Family EGF-type module 0.02
Further Details:      
 
Domain Number 5 Region: 661-759
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000011
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 6 Region: 171-324
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000132
Family Growth factor receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009608
Domain Number - Region: 780-838
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00369
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009608   Gene: ENSMODG00000007737   Transcript: ENSMODT00000009799
Sequence length 1028
Comment pep:novel chromosome:BROADO5:5:248772016:248870706:-1 gene:ENSMODG00000007737 transcript:ENSMODT00000009799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGRGCGCSGAVRAPSLLPLILLLAPLLASGLLPSPLPPEDMDECARGIDNCHVDAICEN
TPHSYKCSCKSGYQGEGKHCEDIDECDNEFNGGCVHECFNIPGNYRCTCYDGFMLAHDGH
NCLDMDECLFNNGGCQHTCINTMGSYECQCKEGFFLSDNQHTCIHRTKEGLSCMNKDHGC
GHLCKETLEGGVACECRPGFELAKNQRDCILTCNHGNGRCQHTCEDKDEGPECSCHPEYR
MHTDGRSCLEKEAYTLDLVESNVTSSVADVDKRVKRRLLMETCAVNNGGCDRTCKDTSTG
VHCSCPMGFTLQFDGKTCKDIDECQNGNGGCDHFCRNTVGSFDCSCKKGFKLLTDEKSCQ
DIDECSFERTCDHTCINHPGTFECACNKGYTLYGFTHCGDTNECSINNGGCQQICVNTMG
SFECQCLSDHQLHWNRKDCVEIKGFLPGNTSPKASLHCSKRGGVDVCYLNCPSDVHFSPG
YQDAYSVTCGASSQPGSQLLKSNDSALLDVATIRTRVTFKLNEGKCNLKKSDLLPDSLPQ
MIQEKYSSVKEGFRYVNLTCGSGKQIPGAFGRPTMTKEMFISVDFELEANQKEVTASCDL
SCVLKKTEKKLRKAIRTLRKTVHREQFHLRLSGLDFEVAKKLPRVPEHLTDPCGLGQEHI
KGKCVSCSIGTYDGGQERCILCPNGTYQDEEGQITCELCPNTEDTRNQQATGARNMSECG
AQCLPGEYSSTGFSPCLPCPLGTYQPEVGRTSCFPCAGSWWGELTTKHPGATTFQDCETK
VQCSPGHFYNTTTHRCIRCSAGTYQPEFGKNYCVSCPGNTTTDFDGSTNITQCKNRHCGG
ELGEFTGYIESPNYPGNYPANTECTWTINPPPKRRILIVVPEIFLPIEDECGDYLVMRKT
SSSNSVTTYETCQTYERPIAFTSRSKKLWIQFKSNEGNSAKGFQVPYVTYDEDYQELIED
IVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLRSKV
SRFLRPYK
Download sequence
Identical sequences F7C453
XP_007497137.1.35504 ENSMODP00000009608 ENSMODP00000009608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]