SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009618 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009618
Domain Number 1 Region: 14-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.99e-46
Family FCH domain 0.0052
Further Details:      
 
Domain Number 2 Region: 440-498
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-23
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 3 Region: 296-367
Classification Level Classification E-value
Superfamily HR1 repeat 0.00000772
Family HR1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009618   Gene: ENSMODG00000007742   Transcript: ENSMODT00000009809
Sequence length 507
Comment pep:novel chromosome:BROADO5:4:178245864:178339440:1 gene:ENSMODG00000007742 transcript:ENSMODT00000009809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDPLTNCSYNKVYKELKEVSQNGENFCKQLTSILQQRANLEISYAKGLQKLASKLTKAL
QSTKKNCICGAWAFASESMKSAADLHQKLGKAIQSEAIKPTHQVLSAQEKKKRTLDNEVE
KMANLVMNNWSQQIKAKKKLMVETKKHEALFHSVERTKQSVTEKEKRKLLGKLKKSTEKL
AKEDESYYQKNIAGYTTRLKWEVTLQNCYQNVLDLEKERIQLLCNILNQYNQHVSIFGQT
LTTGHTQLHCAISKIDVEKDIRTLMEETSISTTEEKSEFLLTDYFEEDPTNGMDKERRKS
SIKSKLSRLKEDIEKASRDKEGLERMINVYTANPSFTDAKTKKETAVLIDETKLKLDLLQ
ANFFKLSSVLAELEQRPKPTHPCISCISKWKEKDQTHSSVKISRPFMTKKLENVVRRTSS
SGLLNNPGSVPLASGITSLGNGTCQALYPFQARGDDELNLEKGDIVTIYEKQNEGWWFGS
LRGKKGHFPSAYVEELPLNNGELSSKA
Download sequence
Identical sequences F7BK92
ENSMODP00000009618 ENSMODP00000009618 XP_001367527.1.35504 XP_007494384.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]