SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009637 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009637
Domain Number 1 Region: 6-76
Classification Level Classification E-value
Superfamily RING/U-box 2.7e-19
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 2 Region: 88-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000104
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 319-383
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000633
Family SPRY domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009637   Gene: ENSMODG00000007756   Transcript: ENSMODT00000009828
Sequence length 432
Comment pep:novel chromosome:BROADO5:2:213075910:213099491:1 gene:ENSMODG00000007756 transcript:ENSMODT00000009828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLGLEEKLVCVICLELYQEAVTLLCGHNFCRKCIEDYWDRGEIDCPHCRTLFKLRPAL
HKNGALCEVVESLRAAEGQPAATEPALGPCPAARCPRHGRALELYCRTEKRCICCVCTVG
QCEGHLRVLADVERKEQEKWLKEQLEENQNQKIKIDEQLKELQDETDRIQNSANTQAVAI
SDKVTCLLRTLEARRDKALQNIEREKMAVLAQAKETKQCLQDHLELLAQNTQQIQELLTC
PNDVGFLQRSPLLTLPGSLASAPSLKWDEDVHQLNELKKMLDQIYQLLLRNETGPGMPRD
VDPGFKGKADLLPLMPLTKPTPGPVCRLRKELRQNYRNLTFDPDTANHHFHLSRQNQRVK
HDSGSQLDTQPGRFQLWQGAVTTGQVGWKGKNERAENNLASFKGSGGCGSSLSSHQCSKW
HLQISWWQGLHP
Download sequence
Identical sequences F7BJC0
ENSMODP00000009637 ENSMODP00000009637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]