SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009642 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000009642
Domain Number - Region: 25-137
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0392
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009642   Gene: ENSMODG00000007761   Transcript: ENSMODT00000009833
Sequence length 454
Comment pep:novel chromosome:BROADO5:6:61670781:61698618:-1 gene:ENSMODG00000007761 transcript:ENSMODT00000009833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAENLVEEFEMKEDEPWYDQQDLQQDLQLAAELGKTLLDRNTELEESLQHMYTTNQEQL
QEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVSDSKASQQKILSLTETIE
CLQSHVDHLQNQMEELKTSSEGRGNQERCEQRKSLHSFSCLKELYDLRKHFVYDHVFAEK
ITSMHNQQTPEEEENKNLKKTITVLQAQLSLERKKRMTMEEEYGLVLKENCDLEQQLGAS
DAYRARALELEAEVAEMRQMLQTEHPFVNGVEKLVPDSLFLSVKEPSQTLLEEMFLAGSE
LSKKPLKRSSSEVVLSSLAGSDIVKGHEETCIRKTEAMKQRGISLLHEVDTQYSALKVKY
EELLKKCQKEEESLKHKAVQTSRGPTPAPNVRSLEAEPVPSSQELASIVPDSSSATSPPP
EYKALFKEIFSCIKKTKQEIDEQRTKYQARSPRS
Download sequence
Identical sequences F7BJ14
ENSMODP00000009642 ENSMODP00000009642 XP_001377305.1.35504 13616.ENSMODP00000009642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]