SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009785 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009785
Domain Number 1 Region: 396-744
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.02e-83
Family YicI catalytic domain-like 0.0000989
Further Details:      
 
Domain Number 2 Region: 746-828
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.63e-23
Family Putative glucosidase YicI, domain 3 0.0043
Further Details:      
 
Domain Number 3 Region: 88-177,264-393
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000000000282
Family YicI N-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009785   Gene: ENSMODG00000007869   Transcript: ENSMODT00000009977
Sequence length 966
Comment pep:novel chromosome:BROADO5:5:300465564:300474309:-1 gene:ENSMODG00000007869 transcript:ENSMODT00000009977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHKMAAVAVRRRRSWARFALACLGLCLSTAFAVDRSNFKTCDQSSFCKRQRAIQPGFSPY
RALLDSLELGPDALTVHLVNEVTKVVLLLELQGLKGNMTRIRIDELKPLRPRYRVPDVLV
ADPPTTRLSVSGRDENSVELTVAEGPYKIILTGRPFRLDLLEDRSLVLSVNARGLMVFEH
QRLPRNSFSEKVSLTFGSIWDKIKNLFSREERKETAEGNGSPNEEAAEKADQPEENREKD
DKDEPGAWEEMFKTHSDSKPFGPTSVGLDFSLPGMEYVYGIPEHAEDLRLKVTEGGEPYR
LYNLDVFQYELYNPMALYGSVPVLLAHSIHRDLGIFWLNAAETWVDISSNTAGKTLFGKM
LDYLQGGGETPQTDVRWMSESGIIDVFLLLGPTISDVFRQYTSLTGTQALPPLFSLGYHQ
SRWNYRDEADVFEVDQGFDNHDLPCDVIWLDIEHADGKRYFTWDSSRFPQPLAMLEHLAG
KRRKLVTIVDPHIKVDSEYPVHEELRSQGLYVKTRDGSDYEGWCWPGSAGYPDFTNIKMR
AWWANMFSFDKYEGSASNLFIWNDMNEPSVFNGPEVTMLKDARHDGGWEHRDIHNIYGFY
VHMATAEGLIQRSGGTERPFVLARAFFAGSQRYGAVWTGDNAAEWGHLKISIPMCLSMGL
VGLSFCGADIGGFFKNPEPELLMRWYQMGAYQPFYRAHAHMDTGRREPWLLAPEYLGPIR
DALRQRYALLPFWYTLFYRAHLDGHPVMRPMWVQYPKDVATFSLDDQFMLGDSLLVHPVA
EPGARGVQVYLPGEGEVWYDTQSHQKHHGPQTLYLPVTFSSIPVFQRGGTIIPRWERVRR
SSDCMKDDPITLYVALSPQGTAEGELYLDDGHTFNYETQNEFLFRKFTFSGNTLTSSSAD
PRGHFETPIWIERVVILGAGKPASVLLETEGIPETILTFHHNAETSVLTLRKPEVHVSTD
WSIHLR
Download sequence
Identical sequences F7EBB3
ENSMODP00000009785 ENSMODP00000009785 13616.ENSMODP00000009785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]