SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009794 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009794
Domain Number 1 Region: 8-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.24e-86
Family L-arabinose binding protein-like 0.0009
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009794
Domain Number - Region: 356-404
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0761
Family TNF receptor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009794   Gene: ENSMODG00000007877   Transcript: ENSMODT00000009986
Sequence length 697
Comment pep:known chromosome:BROADO5:3:523716507:523728592:1 gene:ENSMODG00000007877 transcript:ENSMODT00000009986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPFFFFHIQISYGPFDSILSDESQFPFLYQLAHKDSSLYHGMVQLMIHFEWTWVGLVTTD
DMRGEEFLWNLRRDMIKHGICLAFAEKIPVSERRHTESQDMFVPRIMQSSVKVIVIHGDT
DSLMILRYSQPIDIFLWKVWISTYHWDITMRPQWHDGYSFHGALSFSQMTKDVPGFKTFI
RTVNPDKYPEDILLKDFWCSAFKDQEKLENQDQKECSPNTSLEALSLRFFDMTMTSLSYT
IYNAVHAVARALHEMLLMASEKESIRDGESWTLQPWQLHSFLKNTQFINSAGDQVFVVDS
ENSEAQYDIMKYLFFQNETETLVKVGQFIPNAPLGQDFTICEEEIVQSWFESKYPHAVCT
DSCGLGFRKTSREGEPICCFDCSPCPEGEISHQKSNNMKHCMKCPEEEYPSPERDRCLPK
AITFLDIKEPLGMALACVALFFSVLTALILGVFVKFRDTPIVKANNRTLSYILLISLIFC
FLCSLLFIGHPTTATCLLRQTTFGLVFTVAVSCILAKTIMVILAFKVTIPGRRKMIWLRP
GVSNCVVLLCSGIQVILCGIWLGISPPFPDTDLYSQPNQIIIECNEGSVLGFYSVLGYMG
FLALGSFMVAFLARSLPDTFNEAKFITFSMLVFCSVWVSFLPTYQSTKGKAMVVVEIFSI
LASSAGLLGCIFIPKCYVILLRPHENTQEYIRNKSGQ
Download sequence
Identical sequences F7EB70
ENSMODP00000009794 ENSMODP00000009794 13616.ENSMODP00000009794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]