SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009865 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009865
Domain Number 1 Region: 1060-1331
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.32e-85
Family Class I glutamine amidotransferases (GAT) 0.00000174
Further Details:      
 
Domain Number 2 Region: 653-836
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 8.37e-57
Family PurM N-terminal domain-like 0.0000215
Further Details:      
 
Domain Number 3 Region: 234-440
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 5.93e-47
Family PurM N-terminal domain-like 0.0000236
Further Details:      
 
Domain Number 4 Region: 846-1052
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 7.92e-45
Family PurM C-terminal domain-like 0.000032
Further Details:      
 
Domain Number 5 Region: 443-679
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 3.14e-33
Family PurM C-terminal domain-like 0.0000646
Further Details:      
 
Domain Number 6 Region: 11-161
Classification Level Classification E-value
Superfamily PurS-like 8.89e-30
Family FGAM synthase PurL, PurS-like domain 0.0031
Further Details:      
 
Domain Number 7 Region: 173-233
Classification Level Classification E-value
Superfamily FGAM synthase PurL, linker domain 8.11e-17
Family FGAM synthase PurL, linker domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009865   Gene: ENSMODG00000007928   Transcript: ENSMODT00000010057
Sequence length 1335
Comment pep:novel chromosome:BROADO5:2:254061301:254086364:-1 gene:ENSMODG00000007928 transcript:ENSMODT00000010057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVLRFYVCFSGHEGAASSHTKRKLKEKLTQLQVVETELCYNVNWTGETLPSLQETKKL
EWLFGCPLESNDVARESWLLSGPNDLLLEVGPRLNFSSPASTNIVSVCWAAGLRTVDRVE
TTRRYRLTFTSAPSAEEKAVALATIHDPMTEQYFSQPIQTFSTGNPPAPCNDLIDILTEG
RTALEKANKELGLAMDSWDLDFYTRRFQELKRNPSMVEAFDLAQSNSEHSRHWFFKGRLW
VDGQELEHSLFDAIMSTQATSNPNNVIKFCDNSSAIQGQEVQSLCPEDPSKPSCFQEKTG
IRHVIFTAETHNFPTGVAPFSGATTGTGGRIRDVQCTGQGAHVVAGTAGYCFGNLHIPGY
SLPWEDPNFQYPRNFAHPLEVAIEASNGASDYGNKFGEPVLAGFARSLGLCLPNGQRREW
IKPIMFTGGIGSINAEHVNKESPKPGMDVVKIGGPVYRIGLGGGAASSIQVQGDNASDLD
LGAVQRGDPEMEQKMNRVIRACVEAPGRNPICSLHDQGAGGNGNVLKELSDPAGARIYTS
CFQLGDPTLNALEIWGAEYQESNALLMRSSHQDFMNQVCSRERCPVCYVGTITGDGRIVL
VEDRKCLVGKQNHGDALPSTPVDLKLDWVLGKMPQKEFFLERVPCVLQPLVLPPGLRVLQ
ALDRVLRLPAVASKRYLTNKVDRSVGGLVAQQQCVGPLHTPLADVAVVALSHRDLVGAAT
AIGEQPIKSLLDPKVAARLAVAEALTNLVFAQITDLRDVKCSGNWMWPAKLPGDGVTLAD
ACMAMAAVMCALGVAVDGGKDSLSMAARVGNETVRAPGSLVISAYAVCPDITATVTPDLK
NTGGQGRLLYVPLSPGQHRLGGTALAQCFSQLGTEPPDLDIPENLVLAFNVTQGLLKDHL
LSSGHDVSDGGLITCILEMAFAGNCGIEVDLPFPGTDVLPVLFAEELGLVLEVQELDEAQ
VQKRYQDAGLTCLSIGHTAGDGPHAVVQVAVNGTVVVKETVGQLRALWEETSFQLERLQA
EPSCVNQEEAALRERKGPRYSLPLSFSTKTSVPHVPGGPAPRVAILREEGSNGDREMADA
FHMAGFEVWDVTMQDLCSGAIGLDTFQGVAFVGGFSYADVLGSAKGWAAAVNFNVHAGTE
LRRFRQRTDTFSLGVCNGCQLLALLGWVGRDPNENEKDPTPNTSDTQPGLLLRSNISGRF
ESRWATVRVGPGPALMLRGMEGGVLPVWSAHGEGYMAFSSPGLQAQLEAKGLIPLHWVDD
DGNPTDRYPLNPNGSPGGVAGVCSQDGRHLALMPHPERVVRPWQWAWQPPPFDSLPTSPW
LQLFINARQWCQEGC
Download sequence
Identical sequences F7GI59
ENSMODP00000009865 13616.ENSMODP00000009865 XP_001368241.2.35504 ENSMODP00000009865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]