SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009881 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009881
Domain Number 1 Region: 125-322
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-27
Family SPRY domain 0.016
Further Details:      
 
Domain Number 2 Region: 350-511
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000887
Family Nucleotide and nucleoside kinases 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009881   Gene: ENSMODG00000007941   Transcript: ENSMODT00000010073
Sequence length 645
Comment pep:novel chromosome:BROADO5:5:300527228:300536215:-1 gene:ENSMODG00000007941 transcript:ENSMODT00000010073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPPASQSGPGCPQPPPAPPAPAMAAPAPQSPEPSAPPQPSQGQSQGIGEAEPEAEAAL
APDDQSDQAPTTKAGDDDEPGDEEDSEKSKPTGSDGERRGVKRQRDEKEEHGRAYYEFRE
EAYHSRSKSPPPPEEEAKDEEEDPTLVSLDTYTSDLHFQVSKDRYGGQPLFSEKFPTLWS
GARSTYGVTKGKVCFEAKVTQNLPLKEGCTEVSLLRVGWSVDFSRPQLGEDEFSYGFDGR
GLKAENGQFEEYGQAFGENDVIGCFANFKSEEVELSFSKNGDDLGIAFRVSKESLNERAL
LPHVLCKNCVVELNFGQKEEPFFPSAEEFVFIHAVPVEDRVRTALPPKTMEECEVLLMVG
LPGSGKTQWALKHAQDNPEKRYNVLGAETVLNQMRMKGPEEPEMDPKSRDLLVQQASQCL
SKLVQVASRTKRNIILDQCNVYNSGQRRKLLLFKTFSRKVVVIVPNEEDWKKRLELRKEV
EGDDVPETVMLEMKANFSLPEKCDYMEEVTFGELEKEEAQPLVTKYKEEARRLLPPSEKR
TNRRNNRNKRNRQSRSRGQGYVGGQRRGYDNRAYGQQYWGQSGSRGGYRNFYDRYRGDYD
RFYGRDYDYNRYRDYYRQYNREWQSYYYQDRDRYYRNYYGYQGYR
Download sequence
Identical sequences F7G902
ENSMODP00000009881 ENSMODP00000009881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]