SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009899 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000009899
Domain Number - Region: 122-179
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0968
Family Myosin rod fragments 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009899   Gene: ENSMODG00000007953   Transcript: ENSMODT00000010091
Sequence length 186
Comment pep:novel chromosome:BROADO5:6:124188302:124212741:1 gene:ENSMODG00000007953 transcript:ENSMODT00000010091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTDVQRLQARLEELERWVYGTGEARGSRKVADGLVKVQVALGNISSKRERVKVLYKK
IEDLIKYLDPEYIDRITVPNAAKLQFILAEEQFILSQVALLEQVEALAPLLDSSHIKAVP
KHATRLQALSQIHIQQQDQCEEVTEATKALLEEYNKMTILLSKQFVQWDELLSHLEAAKQ
VKPAME
Download sequence
Identical sequences F7G8T6
ENSMODP00000009899 13616.ENSMODP00000009899 ENSMODP00000009899 XP_001378765.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]