SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009927 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009927
Domain Number 1 Region: 29-490
Classification Level Classification E-value
Superfamily Cytochrome P450 6.16e-124
Family Cytochrome P450 0.000000000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009927   Gene: ENSMODG00000007972   Transcript: ENSMODT00000010119
Sequence length 490
Comment pep:known chromosome:BROADO5:4:384937019:384945643:-1 gene:ENSMODG00000007972 transcript:ENSMODT00000010119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAMWLLFLLCLLLLALVLQGRGLKGSQGRLPPGPMPLPLLGNLLQLGPSGLDKRLMELSR
RFGSVFTVRLGPQPFVVLSGSSALREALLLQADFGGRGGMASFDRCTLGKGIVFSNGHLW
HTLRTFTVGALKKLGLGTRSIEERIREEAAALVQELAVTKEVPFNPLRHIRNAVANVICS
VVFGERYTYEDPDFRTLLDLLNDNFQILSSQWGQMYNIFPSLLDWIPGPHHRIFSNFKKL
QAFISEEIQKHKERRQPEEPRNFIDFFLDQMEKEKQDPRTHFYLETLVMTTHNLFFGGTE
TTSTTIHYGLLILLKYPNIAEKMQEEIDSMVGRARPPCLEDRDRLPYTNAVIHEIQRFIS
VVPMGLPHILTQDTHFRGHFLTKGTNIIPLLISAHQDPTQFKDPENFNPNNFLDDEGAFQ
NNEAFMPFALGKRICLGAGLARMEIFLFLTTILQHFTLCAVKRPEEIDLSPKSTGLGNVS
PPYELRLKPR
Download sequence
Identical sequences F7DQQ1
ENSMODP00000009927 13616.ENSMODP00000009927 ENSMODP00000009927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]