SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009953 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009953
Domain Number 1 Region: 34-503
Classification Level Classification E-value
Superfamily Cytochrome P450 9.17e-130
Family Cytochrome P450 0.000000000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009953   Gene: ENSMODG00000007993   Transcript: ENSMODT00000010145
Sequence length 503
Comment pep:novel chromosome:BROADO5:4:385012288:385021773:-1 gene:ENSMODG00000007993 transcript:ENSMODT00000010145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTPNMDWIGTGLLLLLLGITCLLLAKAAHKTKGRLPPGPRPLPLLGNLLQLRSRDMVTSL
TKVRGKYGSMFTVHLGTRPVVVLSGYDTVKEALVDKAEEFSGRGEYPVFYDFTKGNEKLT
PFPGIAFSNGEKWKVLRRFSIQILRNFGMGKKSLEERILEEEAFLLEELKKTEGAPFDPT
FVLSRSVSNIICSVVFGSRFDYEDERLLKLVHLINENFKIMSSPWGEIYNIFPGLLQWIP
GPHRSLFQNYGSMKTLIDRIIHEHQINLDSTSPSDFIDCFLIKMAEEAKSPDSYFHMETL
VKTTFILIFGGTETVGTTLRHSFLLLMKYPQIQARVQAEIDSVVGRGRRPTLDDRSSMPY
TDAVIHEVQRFADIIPMNLPHRLTRDTLFRGFLLPKGTDIITLLNTVHYDPSQFKTPNEF
NPAHFLDSKEEFKKSPAFMPFSAGRRLCLGEPLARMELFLYLTGILQNFTLQPLCSPEEI
DLTPLSSGLGNVPRPFQLRMVPR
Download sequence
Identical sequences F7D5B1
ENSMODP00000009953 ENSMODP00000009953 13616.ENSMODP00000009953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]