SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009960 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009960
Domain Number 1 Region: 3186-3450
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-52
Family YWTD domain 0.00000266
Further Details:      
 
Domain Number 2 Region: 1425-1686
Classification Level Classification E-value
Superfamily YWTD domain 1.11e-49
Family YWTD domain 0.00000549
Further Details:      
 
Domain Number 3 Region: 2377-2630
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-46
Family YWTD domain 0.00000403
Further Details:      
 
Domain Number 4 Region: 387-648
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-44
Family YWTD domain 0.00000636
Further Details:      
 
Domain Number 5 Region: 4042-4313
Classification Level Classification E-value
Superfamily YWTD domain 1.19e-41
Family YWTD domain 0.0000155
Further Details:      
 
Domain Number 6 Region: 1735-1999
Classification Level Classification E-value
Superfamily YWTD domain 9.02e-40
Family YWTD domain 0.0000883
Further Details:      
 
Domain Number 7 Region: 2073-2322
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-34
Family YWTD domain 0.0000368
Further Details:      
 
Domain Number 8 Region: 717-957
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-28
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 9 Region: 2722-2763
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000668
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 10 Region: 1253-1294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 11 Region: 2844-2884
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000432
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 12 Region: 24-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000759
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 13 Region: 1051-1090
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000851
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 14 Region: 2972-3015
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000106
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 3614-3653
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000117
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 16 Region: 2889-2926
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 17 Region: 1010-1048
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 18 Region: 101-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 19 Region: 3013-3055
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 3131-3179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 21 Region: 256-272,307-376,646-696
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000628
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 22 Region: 3705-3742
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000628
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 23 Region: 1095-1132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 3784-3822
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 3497-3533
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 26 Region: 3533-3576
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000102
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 27 Region: 3056-3096
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 28 Region: 3740-3780
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000105
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 29 Region: 1214-1252
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 30 Region: 1135-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 31 Region: 3573-3615
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 32 Region: 3913-3949
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 33 Region: 2685-2723
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 34 Region: 3827-3863
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000123
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 35 Region: 1173-1211
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 36 Region: 65-100
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 37 Region: 2800-2846
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 38 Region: 1341-1388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000455
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 39 Region: 2007-2056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000119
Family EGF-type module 0.025
Further Details:      
 
Domain Number 40 Region: 2928-2972
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000128
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 41 Region: 1378-1417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000248
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 42 Region: 3870-3907
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 43 Region: 3098-3144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000003
Family EGF-type module 0.013
Further Details:      
 
Domain Number 44 Region: 146-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 45 Region: 1298-1334
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000602
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 46 Region: 3668-3701
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000982
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 47 Region: 181-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 48 Region: 3994-4028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000387
Family EGF-type module 0.01
Further Details:      
 
Domain Number 49 Region: 2766-2805
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000419
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 50 Region: 3956-3995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000648
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 51 Region: 4368-4399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000694
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009960
Domain Number - Region: 2329-2373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000194
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 1689-1731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000289
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 217-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00072
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number - Region: 968-1015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4322-4348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00373
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 3454-3486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0356
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 2641-2701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009960   Gene: ENSMODG00000007996   Transcript: ENSMODT00000010152
Sequence length 4645
Comment pep:novel chromosome:BROADO5:4:178682001:178935035:-1 gene:ENSMODG00000007996 transcript:ENSMODT00000010152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLGTASACTLLILLIACTAQVNCQACDSGQFRCGNGRCIPAHWRCDGAKDCSDDTDEAG
CPHPSCEASQFQCHSDGECIPRAWVCDDEEDCDDGSDEHQQCPGRTCSSQQMTCPNGQCI
PNEYRCDRVRDCPDGADERGCQYPVCEQLTCANGACYNTNQQCDGKIDCRDSSDEVNCTQ
RCLNSQFQCANGECIPRFVCDHDDDCGDRSDEHDCNYQTCRGNFFTCPSGRCIHQSWRAS
DNEACFSSFDKDGHHECYPGEWACPGSGHCIPIEKLCDGTSDCPFGGDETNVTAGRHCNI
SQCATLSCQHRCHSSPTGGICYCPQGYIINSNDSRTCVDFDDCKMWGVCDQLCEDRIGHH
QCHCVEGYVLEQHRHCRANISSGVASLIFSNGRDLLIGDIHGMSFRTLVQSQNRGVAVGV
DFHFYLHRIFWTDTVQDKVFSVDIDGANIQEVLNVSVDAPENLAVDWVNNKLYVVETSVN
RIDMVNLDGTNRVTLITENLGNPRGIALDPTIGYLFFSDWDSLSGDPKVERAFMDGTNRQ
DLIKTKLGWPAGITLDIVSKRVYWVDCRFDYIETVTYDGLQRKTIAHGGSIIPHPYGISL
FEHNVFFTDWTRLAVMKANKFSESNPQIIYQSSLRPYGVTIYHALRQPYVRNPCGNNNGG
CDQVCVLSHRTDNDGLGYRCKCILGFDLHVDGRRCIAVRQFLLFSSQLAVRGIPFNLSTQ
EDVIIPVTGSPSYFVGIDFYAQEDTIFFSDTTKDMIYKQKIDGTGREILTANRVESVEDL
AFDWISKNLYWTDPRYRSISVMKLADKSRRAIVQNLNNPRSIVVHPTGGFVVVHFIPHDH
SSALISQLNFLPFSSQTLNLKMPGISFGALRLYWVDAFFDKIEHSSFDGLDRRTLERINQ
MTHPFGLTIFENYAYFTDWRLGGIVRVRKTDGGEMTIIRRGINNVMHVKSYDANVQTGSN
YCNRATNPNGDCSHFCFPVPNYQRVCGCPYGMKLSSNHLTCVEDPSNEPPTLQCGSYSFS
CNNGRCVPRYYRCDGVDDCHDNSDEQHCGTPNNTCAASAFTCAHGQCIPGRWRCDRHNDC
LDGSDEEHCPTPGPSSCPESLYTCDNNQCIPRIWLCDTDNDCGDGSDEKNCNFTGTCDPG
QFQCPDHRCIDPFYVCDGDRDCADGADEVDCIYNCTASEFKCASGDQCISNIYHCDGVFD
CNDHSDEAGCPTRPPGMCHQNEFQCQSDGTCIPNNWECDGHPDCMDGSDEHNGCLPMTCP
PSLFRCDNGNCIYRAWICDGDNDCRDMSDERDCPTQPFRCPSWQWQCPGHSICVNLSAVC
DDIPDCPNGADESPVCNQESCTDNNAGCTHECIQGPFGAQCLCPFGYQLTNDSKTCEDIN
ECETPGFCSQHCFNERGSSRCWCDEGYILEGNGKTCKVAASGNLLLLVTSRNQIVVDNIT
SQGQNIYSLIRDGEHIVAIDFDSLSGRIFWSDIRQDKIWSAFQNGTDRKVVFDSGVTVTE
SIAVDWVGRNLYWTDYVLETIEVSKMDGNHRTVLISENVTNPRGLVLDPRIDAHLMFWSD
WGKNPRIERASMDGTNRTVIIRDKIYWPNGLAIDYPNKLLYFMDAYLDYIDFCDYDGNHR
RQVVASDLILRHPHALTVFEDFVYWTDRHTHRVIRANKWHGKNQTVMIYNIHQPLGIVAV
HPIKQPSSTNSCASAPCSHLCLLSSSGPRFYSCACPSGWTLSSDSINCLRDEQPFLITVR
MNIIYGISLNPEEKTNDAMVPIAGIQNGYDVDFDDSEQFIYWVENPGEIHRVKSDGTNRT
VFAPASVLGSPISLALDWISRNLYYTNPGTQSIEVLTLQGERRYRKTLITNDGTSLAVGL
PVGITIDPANGKLYWTDRGTESGIPAKVASANMDGSQIKTLFTGNLDHLEFITIDIKEQK
LYWAVTSTGVIERGNVDGTNRMIVVFHLSHPWGIAVHDSFLYYTDKDYEVIERVDKSTGA
NKVALRDNVPNLRCLRVYYRDNAAGSSNGCSNNVNACQQICLPIPGGLFSCACATGFKLN
PDNRTCSPYNSFIVVSMLTAIKGFSLEASDHSEAMVPLAGQGRNALHVDVHMPSGFIYWC
DFSSTVRSQNAIRRIKPDGSSFRNIITNGIGRNGVRGIAIDWVAGNLYFTNAFVTETFIE
VLRINSTYRRVLLKTTVDMPRHLVVDPKNRYLFWADYGQNPKIERAFLDCTNRTVLVSEG
IVTPRGLAVDHSNGYIYWVDDSLDIIARISHEGGDTEMIRYGSRYPTPYGITIFGDSMIW
VDRNLRKIYQASKEPGNTDPPRVIRDNIDWLRDVTIFNAQFQPRLPEQVNYNPCLENNGG
CSHLCFALPGQQAPKCGCAFGELESDGKSCAISTENYLIFASENSLRSISLDPENHSPPF
RTLIVPRTAVALDYDSINNRIYFTQSSTSNGRISYVSLLAGVTSPTVIATDVGIPDGIAF
DWINSRIYYSDFMNQTINSIAVDGSNHTVVARVPRPRAIVLDPCRGYMYWTDWSTNAKIE
RATLGGNFRIHIVNTSLVWPNGLTLDYDEDWLYWADANLQKIERSSLTGTNREVIVSTAI
HPFAMTVYDQHIYWTDLSTRTIYRANKYDGSEQTVMITNLLLRPMDIHVLVKSRQRQCPN
PCSQFNGGCSHICVPGPNGAECQCPSGGRWYLANSNKHCITDNGTRCDGVQFTCLNGRCI
SERWKCDNDNDCGDGSDELESVCAFHTCQPTAFTCGNGRCVPYHYRCDHYNDCGDNSDEA
GCLFRTCDSNTEFACNNGRCISLEYVCNGINNCYDNGTTDERNCPDRTCQSGFTKCQNTN
ICIPRTYLCDGDNDCGDMSDESPTHCVSLTCTSNEFRCTSGRCIPAHWYCDQGVDCADGS
DEPPSCVSHVRTCSVDQFRCDDGRCIPNTWICDGDNDCGDMSDEDQRHNCAARNCTRSEF
TCVNNRPPLRRCIPRAWICDGDADCSDAYDEHQNCTRRNCTENEFTCANGLCIRNSYRCD
RHNDCGDSSDERGCVYPPCQQYQFTCQNGQCISKVYLCDGDNDCGDLSDELEHLCTTPEA
TCPPHQFKCDNGNCIEMMQICNHLDDCGDNSDEKGCGINECNDPSISGCDHNCTDTRTSF
YCTCLPGYKLMSDKKTCDDVDECNETPSVCSQMCENTAGSYICKCARGYIREPDGKRCRQ
NSNISPYLIFSNRYYLRNLTADGQSYSLILQGLGMAVALDFDRVEKRLYWIDLERQVIER
MFLNGTNKETIINSNLPAGEGLAVDWVARKLYWLDAYLNCLSVANLDGRFRRRLAEHCMD
SNNTFCFQYPRGIVLHPKYGQVYWTDWADQPYIGRVGMDGTNKTVIISTKLAWPNGITID
YTNDKLYWSDAHLSYIEFSDLEGRHRHTVLDGTLPHPFAITIFEDTLFWTDWNTRTVEKG
NKYNGSGRMVLVNTTHRPFDIHVYHPYRQPIVNNPCGTNNGGCSHLCLIKAGGQGFTCEC
PDNFQTLQIGSATHCLPMCSSTQFLCADSERCIPISWKCDGQRDCRDGSDEPSTCPQRYC
QIGQFQCNDGNCTNPHFLCNAVRDCPDGSDEEHVLCVNHQCEIHQWQCANKRCIPEAWQC
DTEDDCGDNSDEDSAHCASRTCLPGQFKCDNGRCIPQSWKCDVDNDCGDHSDEPIHECMG
PDYRCNNHTDFSCKTNYRCIPQWAVCNGYDDCRDNSDEQGCEEMTCNPLGDFRCNNHHCI
PLRWKCDAFDDCGDGSDEQNCTPRECSESEFRCDNQRCIPSRWICDHDNDCEDNSDERDC
ELRTCHPGYFQCTSGHCVPEQFKCDGSADCLDFSDEATCPTRYPNGTYCSATMFECKNHV
CIQPLWKCDGDDDCGDSSDEELHLCLDNPCNPPFRFRCENNRCIYSHELCNQEDDCGDGS
DEKPEHCMNSTTKPCVEDEFKCGNGHCIPLSYVCDNFDDCGNHFDETGCNPGAERTCDEN
ICEHNCTHLKEGGFICSCRPGYSAGPVDRNSCVDINECEQFGVCPQDCKNSKGSYECICA
DGFRSVGDHEGKQCAADGNPPILLLPDNVRIRKYNLSSEQYSDYLDNQEHIQAIDYDWDP
EGIGLSIIYYTVLGQGSVFGSIKRAYIPTFDSSGNNPVKEVDLNLKYIVRPDGIAVDWVG
RHIYWSDASTNRIEVAKLDGRYRKWLISTQLDQPAAVVVNPKLGFMYWTDWGSQPKIERA
WMDGQQRQTLISDDLGWPTGLSIDYLNNDRIYWCDSKENIIESMKHDGTDRRLVSSEVGN
PYSLDVFEGHLYWTSKEKGEVWKEDKFGRGERVKVLTVNPWLTQVRIYHEHRYNHSVRNI
CKDVCSHLCLLRPGGYTCSCPEGTRFVEGSSTQCDAAIESPPTMPPACRCMYGGTCYIDE
SGHPKCKCPTGYTGSYCELGLSRGMPAGTTAVAVLLTILLILLIGALVIGGFFNYKRTGS
LLPSLPKLPSLSSLVKSTENGSGVTFRSGADVSMEIGVSGFGPDSAIDRAMQMNENFAVE
TGKQPIIFENPMYAARDSIVNVDQQAPVTEFRNEDNPNYENPISSSEIVVDEKQPSTSAE
ATQGTEAAQSKWNFFKRKLKQSTNFENPIYAEMEKEQQEVTAAVPPPSPSLNTDITQRKD
QTPAYVATEDTFQDTANLVKEDSEV
Download sequence
Identical sequences F7CLL4
ENSMODP00000009960 13616.ENSMODP00000009960 ENSMODP00000009960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]