SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009982 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000009982
Domain Number - Region: 98-164
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00445
Family Myosin rod fragments 0.006
Further Details:      
 
Domain Number - Region: 12-84
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0497
Family Myosin rod fragments 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009982   Gene: ENSMODG00000008019   Transcript: ENSMODT00000010174
Sequence length 344
Comment pep:novel chromosome:BROADO5:2:253741170:253807094:-1 gene:ENSMODG00000008019 transcript:ENSMODT00000010174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGEEIPDFSSLKEETAYWKGLSLKYKQSFQEAQEELVEFQEGSRELEAELEAQLVQAEQ
RNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQ
ANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQE
LAVRERQQEVTRKSAPSSPTLDCEKMDSAVQASLSLPATPVGKGTENSFPSPKGIPNGFG
TSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQASRKSYISGNVNCGLVNSNS
TKFSRSGHTSFFDKGTVNGLDQVPPTGLGSSRPSSAPGMLPLSV
Download sequence
Identical sequences F7CL14
13616.ENSMODP00000009982 ENSMODP00000009982 XP_007483177.1.35504 XP_007483178.1.35504 ENSMODP00000009982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]