SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010052 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000010052
Domain Number - Region: 516-587
Classification Level Classification E-value
Superfamily Prefoldin 0.0863
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010052   Gene: ENSMODG00000008079   Transcript: ENSMODT00000010245
Sequence length 654
Comment pep:novel chromosome:BROADO5:6:253511895:253532236:-1 gene:ENSMODG00000008079 transcript:ENSMODT00000010245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGFLGAPGRREKREEEAYSSDLLVRCGPFLLPPSAPASAPARGRSAPSTVMEAPATRLL
VLLWIVGVASSATASEVQLVNEDVKRTVDLSSHLAKVTADVLLVNPSASAGPVSSFLLAL
EPALEARLAHLGVQLKAEEEEENHLEVREVKLKGKSGKIFTVKLPYPLSGGAKIRVVIET
VYTHALQPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRAKLASRNVESYTKLGNPTR
SEDVLDYGPFKDIPAFSQDPFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEETVDLKHT
GAVLKGPFSRYDYQRQADSGISSIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVE
MEIRPRFPLFGGWKTHYIIGYNLPSYEYLYNLGDQYALKMRFVDHVFDEQVTDSLTVKII
LPEGAKNIQVDSPYEISRAPDELHYTYLDTFGRTVIVAHKNNLVEQHIQDIVVHYTFNKI
LMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRLGLY
RHFDEAVNKYKQSRDVSTLNSGKKTLEMEHKSLTNEIASLQSRLKTEGSDLCDKVSDVQK
LDSQVKDLVLKSSLEAERLVAGKLKKDAYIENEKALSSRRQELVTKIDNILDAL
Download sequence
Identical sequences F6YJ80
ENSMODP00000010052 XP_001378255.2.35504 ENSMODP00000010052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]