SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010079 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010079
Domain Number 1 Region: 503-629
Classification Level Classification E-value
Superfamily TIMP-like 7.85e-28
Family Netrin-like domain (NTR/C345C module) 0.067
Further Details:      
 
Domain Number 2 Region: 396-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 3 Region: 262-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.041
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010079
Domain Number - Region: 91-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0128
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010079   Gene: ENSMODG00000008108   Transcript: ENSMODT00000010273
Sequence length 629
Comment pep:novel chromosome:BROADO5:8:72630742:72781227:-1 gene:ENSMODG00000008108 transcript:ENSMODT00000010273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCARLLLFWGCSAVAAGLSGVTGVGSHCEKACNPRMGNLALGRRLWADTTCGRNSTEL
YCSYIENADLTCRQPKCHKCNAAHPHLAHLPSSMTDSSFRFPRTWWQSAEDAHREKIQLD
LETEFYFTHLIMVFKSPRPAVMVLERSQDFGKTWKPYKYFAANCSATFGLEDDVVEKGAI
CTSRYSSPFPCTQGEVIYRALSPPHFAEDPYSAQAQEQLKITNLRVQLLKRQSCPCQGND
LNTKPQHFSHYAIYDFIVKGSCFCNGHADRCGPADGFRPVKVAGAFQVVHGKCACKHNTA
GSHCQYCAPLYNDRPWQAANGKTGAPNECRSKKCRGKSLVALYDVNILSSRKESGSTRDG
KQRYDSKGQHLFRGKPYLQNLKEEDGILYLDSLAVCSCHPIGSAVLPFSSVTFCDPTNGD
CPCKPGVAGPHCDKCMVGYWGFGVYGCRPCDCAGSCDPLTGDCISSSADFDWYHERPDFY
SVFNHSEPTWEWEDEQGFSALRHSGKCECKEQSLGNPKIFCGMKYSYVLKIKILSAHDKG
SHAEVNVKIKKVLKSTKLKILRGKRTLYPESWTNRGCTCPILNPGLEYLIAGHEDVRSGR
LVVNMKSFVQHWKPALGRRVMEILKRDCK
Download sequence
Identical sequences F7G5T9
13616.ENSMODP00000010079 ENSMODP00000010079 ENSMODP00000010079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]