SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010134 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010134
Domain Number 1 Region: 60-440
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.13e-39
Family Amylase, catalytic domain 0.0027
Further Details:      
 
Domain Number 2 Region: 444-489
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000101
Family alpha-Amylases, C-terminal beta-sheet domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010134   Gene: ENSMODG00000008156   Transcript: ENSMODT00000010330
Sequence length 537
Comment pep:novel chromosome:BROADO5:5:300789421:300794499:1 gene:ENSMODG00000008156 transcript:ENSMODT00000010330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQEAEVDMKEVELNELEPEKQPMNAAAPPSAASGGEKNGVVKVKVPDDEADAAAAAAAA
AKFTGLSKEELLKVAGSPAWVRTRWALLLLFWLGWLGMLAGAVVIIVQAPRCRELPTQRW
WHQGPVYRLGALKAFQGQPSNGTAGLAGVKARLDYLSTLKVKALVLGPIHKNVQDDLGGT
DLQQIDPALGTLQDFTNLLLEAKKKNIHIVLDLTPNYRGRSSWFLPHQSEEVNERMKEAL
SFWLNNGVDGIQVLDVQNLTDASSALSQWSNLTHSISEDNVLIVGTEASELSQLMSLLND
TDLLSSSYLEDFGRRSSSGRELKDLVTSYLDATGGHWCTWTYSQVGHLASLVPAHLLRLY
HLLFFTLPGTPIFSYGDEIGLQAALPGQPAEAPIMLWDEKTLGPSESVNLNMTVQGQNEN
PGSLLSEFRKLSDSRGKERSLLHGDFLVLPTTDDLFAYVRRWDQNERFLVVLNLGSSSRQ
TELKVPPGAPGQKLELPEKAALMLSTQRSHPEGSLLPLRQLTVAPGEGLLLKFPYVA
Download sequence
Identical sequences F7ELC1
ENSMODP00000010134 XP_001367411.2.35504 ENSMODP00000010134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]