SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010173 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010173
Domain Number 1 Region: 68-640,673-884
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.54e-292
Family Motor proteins 3.41e-16
Further Details:      
 
Domain Number 2 Region: 885-1009
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.05e-22
Family Myosin rod fragments 0.00022
Further Details:      
 
Domain Number 3 Region: 1004-1119
Classification Level Classification E-value
Superfamily Myosin rod fragments 7.72e-21
Family Myosin rod fragments 0.0014
Further Details:      
 
Domain Number 4 Region: 1284-1399
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.16e-17
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 5 Region: 1397-1498
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000968
Family Myosin rod fragments 0.006
Further Details:      
 
Domain Number 6 Region: 42-75
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0000118
Family Myosin S1 fragment, N-terminal domain 0.00082
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010173
Domain Number - Region: 1507-1618
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00157
Family Myosin rod fragments 0.0068
Further Details:      
 
Domain Number - Region: 1732-1848
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00186
Family Myosin rod fragments 0.0046
Further Details:      
 
Domain Number - Region: 1871-1969
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00262
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 1595-1708
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.034
Family Myosin rod fragments 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010173   Gene: ENSMODG00000008180   Transcript: ENSMODT00000010369
Sequence length 2016
Comment pep:novel chromosome:BROADO5:2:253512405:253690470:1 gene:ENSMODG00000008180 transcript:ENSMODT00000010369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGIIPLYISFTMAQRSGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAAS
IKEERGDEVMVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRY
YSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDR
EDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRKDHNIPPESPKPVKHQAKLERQLL
QANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDER
TFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFS
HDEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTP
RIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILD
IAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIEWNFIDFGLDLQPCI
DLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGTHSKFQKPRQLKDKADFCIIH
YAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDEIQNIQRASFYDNISGLH
DLPVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLSKLMATLRNTNPNFVRC
IIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPK
GFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCR
GYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKD
EELLKVKEKQTKVEEELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQ
LEEILHDLESRVEEEEERNQVLQNEKKKMQGHIQDLEEQLDEEEGARQKLQLEKVTAEAK
IKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKSKNLAKLRNKQEVMITDL
EERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIEELKIQLAKKEEELQGALARG
DDETLHKNNALKVVRELQAQIAELQEDLESEKASRNKAEKQKRDLSEELEALKTELEDTL
DTTAAQQELRTKREQEVAELKKAIEEETKNHEAQIQDIRQRHASALEELSEQLEQAKRFK
VNLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVTEGDRLRVELA
EKASKLQNELDNVSTLLEEAEKKGIKFAKDAASLESQLQDTQELLQEETRQKLNLSSRIR
QLEEEKNNLQEQQEEEEEARKSLEKQVLVLHSQLADTKKKVDDDLGTIESLEENKKKLLK
DIEALSQRLEEKALAYDKLEKTKTRLQQELDDLMVDLDHQRQIVSNLEKKQKKFDQLLAE
EKNVSARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRTDMEDLMSS
KDDVGKNVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNMQAMKAQFERD
LQARDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKKKMEMDLKDLEAQIETANKG
RDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKENEKKLKSLEAEILQLQEELASS
ERARRHAEQERDELADEIANSASGKSSLLDEKRRLEARIAQLEEELEEEQSNMELLNDRF
RKATLQVDTLNSELAGERSAAQKSESTRQQLERQNKELKAKLQELEGSVKSNLRAPFFVL
KPKFNFSLDTCRFHRERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMK
QLKRQLEEAEEEATRANASRRKLQRELDDAIEANEGLTREVSTLKNRLRRGGPITFSSSR
SSRRQLHIEGASLELSDDDTESKTSDVNEMPAAPVE
Download sequence
Identical sequences F7E4E2
ENSMODP00000010173 13616.ENSMODP00000010173 ENSMODP00000010173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]