SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010210 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010210
Domain Number 1 Region: 32-476
Classification Level Classification E-value
Superfamily Cytochrome P450 3.27e-125
Family Cytochrome P450 0.000000000114
Further Details:      
 
Domain Number 2 Region: 479-634
Classification Level Classification E-value
Superfamily Cytochrome P450 2.62e-31
Family Cytochrome P450 0.00000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010210   Gene: ENSMODG00000008215   Transcript: ENSMODT00000010407
Sequence length 648
Comment pep:novel chromosome:BROADO5:4:385030981:385054196:-1 gene:ENSMODG00000008215 transcript:ENSMODT00000010407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVSGLLLGALFFCLSALVVLSVWRQRKVRGSLPPGPTPLPFIGNYLQLNTKQMYDSIMK
IGEKFGPVFTVHLGPRPIVVLSGYEAVKEALVDQAEEFSGRGEQATFDWLFKGFGVAFSN
GERARQLRRFSITTLRDFGMGKRGIEERIQEEAGFLVEALRGTKGAPIDPTFFLSRTVSN
VISSIVFGDRFEYEDKQFLSLLRMMLGSFQFTATSMGQLYEMFSGVMKHLPGPQQQAFKE
LQGLEDFITEKVRENQATLDPNHPRNFIDSFLIKMQEEKKNPNTEFFMRNLTMTTLNLFF
AGTETVSTTLRYGFLLLMKHPEVEAKIHEEIDRVIGRNRSPKFEDKAKMPYTEAVIHEIQ
RFGDMIPMGLARRVTKDTKFRGYLIPKGTEVYPMLGSVLRDQSFFACPQDFNPQHFLDEK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTTILQNFRFQSPLPKEAIDISPKMLSL
KYGPVYTFHLGSRPCVVIAGYQALKESLIDRAEEFGGRGEFPAVQMWSHGDGIVYGKGER
WKQLRRFAIATLKNFGMGKRSLEERIREEAQHLCEEFQKTEGAPFDPTFFLSCAGSNIIS
SLVFGDRFAYDDPKFLELMALINSNWRIMSSFWGQVSSVVEMMSGKVL
Download sequence
Identical sequences F6ZYH4
ENSMODP00000010210 ENSMODP00000010210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]