SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010212 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010212
Domain Number 1 Region: 3-461
Classification Level Classification E-value
Superfamily Cytochrome P450 3.01e-64
Family Cytochrome P450 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010212   Gene: ENSMODG00000008217   Transcript: ENSMODT00000010409
Sequence length 462
Comment pep:known chromosome:BROADO5:3:173282690:173444252:1 gene:ENSMODG00000008217 transcript:ENSMODT00000010409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPGEPPLINGWIPFFGVAFQMKTDPFKKLKEYQKKYGDFFTLYINGKYFTFVLDPFQYPL
VLKNHKQFDFFKFSNEIIHKVFTVSYRAQVMEKMKENYKYLQSKLLEKTVYNLMQNLQHV
IKKQLLQTKNWEMSQLFKFCKSIMFEATYVTLYGKDPSPNSDEVIPELLEHFDKFDNEFL
NFLFPIPTLSLRAAKISREKLIQNFSSEHMYKMLETSEIIRSRRNCLEKFTELPDHEKGA
HHLVFLWASVANTIPTTFWTVYYLLQHPEAVAVLREEINHLLQSTGQKKEPDFNVQFTRE
QLDSLVYLDSIIFEALRMISASANLRVNEEDFTLSTDKGEINLRKGDSIIIYPPMLHFDP
EVFEQPEEFKFDRFVKDGKKKTTFFKRGQELPYCLMSFGSGITKCPGRFFAVFEIKQLLI
LLFMFFDMELIEKEPLQFRKSRMFFGIQCPQSDVSFRYKLRC
Download sequence
Identical sequences F6ZYF3
ENSMODP00000010212 ENSMODP00000010212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]