SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010216 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010216
Domain Number 1 Region: 24-58
Classification Level Classification E-value
Superfamily Cytochrome P450 0.0000682
Family Cytochrome P450 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010216   Gene: ENSMODG00000023725   Transcript: ENSMODT00000010414
Sequence length 60
Comment pep:novel chromosome:BROADO5:4:385116404:385116583:-1 gene:ENSMODG00000023725 transcript:ENSMODT00000010414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASGLLLVTLGFCLSTLVVLSVWRQRKLRGSLPPGPTPLPFIGNYLQLNTEQMYDSLMK
Download sequence
Identical sequences F6ZYC0
13616.ENSMODP00000010216 ENSMODP00000010216 ENSMODP00000010216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]