SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010253 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010253
Domain Number 1 Region: 3101-3413
Classification Level Classification E-value
Superfamily BEACH domain 5.1e-111
Family BEACH domain 0.000000122
Further Details:      
 
Domain Number 2 Region: 3531-3778
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.98e-31
Family WD40-repeat 0.0092
Further Details:      
 
Domain Number 3 Region: 3003-3106
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-22
Family PreBEACH PH-like domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010253
Domain Number - Region: 1540-1686
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00313
Family Clostridium neurotoxins, the second last domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010253   Gene: ENSMODG00000008251   Transcript: ENSMODT00000010451
Sequence length 3792
Comment pep:novel chromosome:BROADO5:2:153974915:154223651:1 gene:ENSMODG00000008251 transcript:ENSMODT00000010451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDSNSLAREFLTDVNRLCNAVVQRAESKEEEEEETHMAALGQYLVQGRGFILLTKLNL
LIDQALTCREELLTLLLSLLPLVWKIPVQEEKALDFNLPFSSDIIWTKETNSSSLRHTQE
KLHLEGSTQTGQVSAKASISRRSRRHRKPPHHYSVRDERKSQLSTSDSEANSDDKSIAMI
KHRRSNLLQRFLSSSSKENQPLIRQTERPDTVILENVRPIIPRHESNSDILNESAAFSII
SNMNNSPFDLCHVLLSLLEKVCKFDITLNHNSALAVSVVPTLTEFLAGFGACCSLSGNSE
SEVSTGWTEEPIALVQRMLFRTVLHLMSVDINTAETMPESLRKNLIDLLRAALKIRACLE
KQPDPFSPRPKKTLQEVQDDFVFSRYRHRALLLPELLEGVLQILICCLQSATSNPFYFSQ
AMDLVQEFIQHHGFKLFETAVLQMEWLVSRDEVSIGASEHLRTLINSVMKIISTVKKVKS
EQLHQSMCTRKRHRRCEYSHFMHHHRDLSGLLVSAFKNQISKNPFEEMADGEVYYPERCC
CIAVCAHQCLRLLKKVSLNTTCIQILSGVNNVGICCCMDPKSVIIPLLHAFKLPKLKHLQ
QHILNILNKFILDQLGGGEISQKTKYATCNICTFDHDQLAQLEETMHAISHNADPASLSS
PSYKSQGILPSSGFEDLLWKWDALQAYQSILFEEDRLHSVHIASHICNLIQKGNAIVQWK
LYNYIFNPVLQRGVELAHHSQQLGVSSSCSNACSYHSQCLLQEVLQIYLQTLPTLFKSRV
IRDLFLSCNGVNQMIELNYLDGIRNYSLKAFETLIASLGEQQKDEIIPEVDGINKEKKVS
SIVTSSLKQQVCSDSSQSLSKFYAGLKEICPKKQKAVGQDIHINMINLFLCVAFLCVSKE
ADCDRDSTNDSEDTSGYDSTASEPLNHMLPCLSPEILILPSPEHIHRAADIWSMCRWIYM
LNSVFQKQFHRLGGFQVCYKLIIMIIQKLSRNKEKARKVDNHIYANENTDFEGNVQSEMT
VKEDALHLSVNNASSPLVLGSLEENTESLDQLDSQEISSEYFLSIKPISTSVAALKEPKV
SSQEHECTLQSIRLLEALLTICLHSSKTNQQKIEVELPNQTLSVENVLFEIQDHLSQSKV
VETDLAKPVLDALLRVALGNYSADLNHSEEKIEKIHQTESEAVLQQGDLSEEVEETHGSF
KLFAEEEGYEADSESDPEDSESQDEGKVGLNLKVKCISSSSYLNDAIENFAQGELIYPEI
CILELNLLSTSKVRVAVLGHVFESFLKIIRQKEKNVTLLMQKGIVRNLLGGFLNILTRDD
SSLQACQIVLMDLLVSLMSSRTCSEELTFLLRIFLEKSPSTEILLKGILKIIEADTNMSP
LQYLTFPLFHIPNLSSNSFAQKYGSILNSKAIGLLRRATFSQSKKEADSEIFPHQLLSSW
HVAPIHLPLVGQNCWPHMSEGFSVSLWFNLESVHEAENTLEKGKRIKKRKKTSFIQDDSL
DDTDENKSESVECMNSGEKLLEEGCIHLISLGSKALMIQVWADLSTGAFIFRMCIDSNDD
TKVGLIAQAESQENIFLLGKWQHLALTYFQQPEGKKNIHGKFSMWVSGQRKPDVTLDYTF
PRRTSLSSDSNKTFCMIGHCSSSQEEFLRLAGRWDLGNLLLFNGAKIGSQEAFYLYACGP
DYTSLMPCKYGKPVNDHSKYISKEILQCEQIRELFMTQKEVDIDLLIEGLAIVYTTCYPA
QYTIYEPVIRLKGQVKAAQSQRPFSLKEAQSSLLKPHYLKCLQPTEYKSLQGILHEIGGT
GAFVFLFARVVDISGCEEIQALALQVILSLTKYNQQRIQEIENCNGLSMIHQLIKQKCIV
GFHIKTLLKSCCGEEILSINENGHFKLDIESTAVIQDVKLLEELLLDWKIWSKAKQGVWE
TLLAALEVLIRANHHLQMFNIKQLLKARVVHHFLLTCQVLQEHKEGHLTSMPREVCGSFV
KIIQEVLGSPPDLELLTLIFNFLLAVHPPTNTYVCHNPTNFYFSLHIDGKIFQEKVQSIM
YLRHSSSGGKSIASPGFKVISPSGFAASFSEGSSSSNIIPLHNIVQILHSRSVPASPASS
PLVQPRKLSGSLGWSVDNLQNIPDNDISTQPEKVNSGESVEILKKVQEEIFVSSCESAKT
ICESEELPSPQIFVNDVPKLESEEYPSIVLDNKDSHAEVRFDGDSPGDEFSLRRPDNLKG
LSSFQRSHSIIASLGLAFPSQNGSSAVSRWPSLADKNIVSEDWENFTFSPGYEQTYNQST
SADSSTEDCLVLICCGLYDLLRGVLLILPDIMLEHVMDKVVQPDTLIVLLNHPSPLIQQG
VIKLLDAYFIRASKEQKDKFLKNRGFALLANQLYLHQGTQKLLECFMEMFFGCPIILDEE
FDLEEVKNMELFQKWCIIPVLGLIETSLSDNILLHNSLFLLLQILNSCSKVADLLLDNGL
LFVLCNTIAALNGLETNIPLNDYKLLVCDIQQLLVAVTIHACSSSGSQYFRVIEDLIVLL
GYLQKSKNKRTHNMAIALQFRVLQAAIEFIRTTANQDSQNLINSFQFPSIPHYAIFQKRK
SIAGPRKSSLAQSESLLMKMRSVASDELNMMMQRRMSQENPIRASETELTQRMQRLIVLA
FAGLVITEELHQDFIDILSIPGTTTQGKTSNSEAEISEEEIQPEELSILNPFQKEMLLIM
VEGMRIALGSSRTTTPRQQWNKILCSCKETFRMQLGRLLVHLLSPTRPPQQRKQAFEILR
LPNHQEILRDCLSPTLQHGAKLVLYLNEFLHNHQEELTEEELTTARLFMNILKLSGHKCT
LPSLPTKSDFLKVIKEELMKYEIEESVNKSTWQKTVNNNQQSLFQRLDMKSRDISKIAAD
ITQAVSLSQGIERKKVIQHIRGMYKVDLSSSRRWQELVQQLTHDRALWYDPVSYPTSWQL
DPTEGPNRERRRLQRCYLTIPNKYLLKDRQKSEEVIKPPLSYLFEDKTHSSFSSTVKDKA
ASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDTVESSSLQGETEPASFSWTY
EEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKIRDDVYHNILTNNLPNLLEYGNIS
ALTNLWYSGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILSDYISETLDLNEPSVYRNL
SKPIAVQYKEKEDRYVDTYKYLEEEYRKGAREDDPMPPVQPYHYGSHYSNSGTVLHFLVR
MPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYLPEFLVNREG
FDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDHVSQNICQWIDLVFGFKQKGK
SSVQAINVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQLFHTAHTSRPGSKLSI
EGELPTAVGLFVQLAFRETREPVKEVVYPSPLSWIKGLKWGEYVGSPSAPMPVVCFSQPH
GERFGSLQALPTKAICGLSQKFCLLMIYSKEQGVRSMNSTDIQWSAILSWGYADNILRLK
SKQSEPPVNFIQSSQQHQCPICAWVPDSCQLFTGSKCGVITVYMNKFTSNTPSEIEMESQ
IHLYGHTEEITSLFVCKPYSIMISVSKDGTCIIWDLNRLCYVQSLAGHKSPVTAVSASET
TGDIATVCDSVGGGSDLRLWTVNGDLVGHVHCREIICSVAFSNQPEGISINVIAGGLENG
IVRLWSTWDLKPVREITFPKSNKPIVSLTFSCDGHHLYTANSDGTVIAWCRKDQQRLKQP
MFYSFLSSYAAG
Download sequence
Identical sequences F6ZX68
ENSMODP00000010253 ENSMODP00000010253 13616.ENSMODP00000010253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]