SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010301 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010301
Domain Number 1 Region: 31-315
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.19e-43
Family Class I glutamine amidotransferases (GAT) 0.0000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010301   Gene: ENSMODG00000008291   Transcript: ENSMODT00000010501
Sequence length 315
Comment pep:novel chromosome:BROADO5:3:175619115:175657970:1 gene:ENSMODG00000008291 transcript:ENSMODT00000010501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSWQRLCALGTVLLCFVRGDVPREDINERPIIGILAQSHKEDLQGLGKYYIAASYVKY
LESAGARVVPIRTTLSDEEYDNLFNSINGILFPGGGVDLQTSKYSYVARLFYDKAKQAFK
RGDYFAIWGTCLGFEELTVLTSGKQLLTPTNTSGIALPLNFTKAINESRMFQNFPKDLLV
ALATEPITSNFHKWSLSLKTFMENKKLSEFYTVLSTNTYKGIEFISTMEAKEYPIYGVQW
HPEKNAFEWKKLKGLVHSPVGIRMSFYMADFFVNEARKSHHRFASKEEEEKALIYNYEPV
FTGNYSSFQQCYFFD
Download sequence
Identical sequences F7FU03
XP_007487124.1.35504 ENSMODP00000010301 ENSMODP00000010301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]