SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010364 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010364
Domain Number 1 Region: 32-495
Classification Level Classification E-value
Superfamily Cytochrome P450 2.49e-130
Family Cytochrome P450 0.0000000000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010364   Gene: ENSMODG00000008331   Transcript: ENSMODT00000010564
Sequence length 495
Comment pep:novel chromosome:BROADO5:4:385132088:385143290:-1 gene:ENSMODG00000008331 transcript:ENSMODT00000010564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFGGAITLFLALCVPCLVILIAWKRMHKGGKLPPGPTPLPFLGNLLQVRTDATFQSFLE
LSKKYGPVFTVYMGPRRVVVLCGHEAVKEALVDQAEEFSGRGELASIDRNFQGHGVALAN
GDRWRILRRFSLTVLRNFGMGKRSIEERIQEEAGFLMEEFRKTKGTPIDPTFFLSRTVSN
VISSVVFGSRFDYEDKQFLYLLHLINESFIEMSTPWAQVLYDMYSGIMQYLPGRHNKIYN
LIEELKDFIASRVKINEASLDPNNPRDFIDCFLVKMHQEKNNPKTEFNLKNLVLTTLNLF
FAGTETVSSTLRYGFLLLMKYPEVGAKVQKEIDHVIGQNRIPKAEDRMQMPYTDAVIHEI
QRLTDIVPMGVPHTVTQDTNFRGYILPKGTDIFPLIGSALRDPKYFKKPEAFEPQHFLDE
EGRFKKNEAFVPFASGKRVCLGEAMARMELFLYFTTILQNFSLQPLVPPSEIDITPQISG
FGNIPPTYKLCIVAR
Download sequence
Identical sequences F7F2M9
ENSMODP00000010364 13616.ENSMODP00000010364 ENSMODP00000010364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]