SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010397 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000010397
Domain Number - Region: 1099-1199
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00222
Family Myosin rod fragments 0.0026
Further Details:      
 
Domain Number - Region: 832-944
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00366
Family Myosin rod fragments 0.0053
Further Details:      
 
Domain Number - Region: 1197-1265
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00968
Family Myosin rod fragments 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010397   Gene: ENSMODG00000008365   Transcript: ENSMODT00000010598
Sequence length 1316
Comment pep:novel chromosome:BROADO5:1:163728811:163922367:-1 gene:ENSMODG00000008365 transcript:ENSMODT00000010598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELYFGEYKHVQQEYGVHLRLESEETKKSRLSQNAKTGSYGVSIRVQGIDGHPYIVLNNT
ERCLAGIPFAENGPSFTSPGINDLGLHSNMDPRLEEKASEEIQFPENPYVQPSAFRSLKP
ASLYEGKNGLLEHKDSSLKSSSMLNFQRHPELLQPYNPEKNELNLETHKSPECNWTKMLT
DETKNDKRSRTCFSKPASSQPASMPSGDMSKCNVTAIRLCSSIVIDDPKKQASVCLNVQS
CANEGLTTGSSTPSEKPLTTIHPDTHQESKKIRPDVLPFRRQDSAGPVLDGYRSRRSSSS
SVTPTSANSLYKFLLDDQDYAIHADNVNRHENRRYIPFMPGTGRDIDTGSIPGVDQLIEK
FDQKVGSQRRGRSGKRNRIHPDDRKRSRSVDSAFPFGLQGDSEYLDEFSRNLGKSSEHLL
RPSQVWQQKPLSRERRLLSGGKHTMVVQTSGKLKEQGQDSLDGQPRLSQLNNANKVHENK
VNKDSGMMGPTILSAQNKKEEMKTATATVVLQNQAASILPDAGTKKISIKTLSSATNTQA
TPDLLKGQQELAQQTNEETAKQILYNYLKEGSTDNDDATKRKVNLVFEKIQTLKSRAAGS
AQGNNRVSDSSAEVRELLEQRNKLNREVSELQKQLNLEIKNQQNIKEERDRMRSNLEELQ
SQHEEKEKETLTLQKRLDDSEMELRKNLEELFQVKMEREQHQTEIRDLQDQLSEMHDELD
NAKHSDDGEKGALIEELLQTKRDLQDILIAKEEQEDLLRKRERELTALKGALKEEVSSHD
QEMDKLKEQYDAELQALRESVEEATKNVAVLAHRSSTSQPTQVEAENQVKILTEENEKLQ
KKIKELEVSMTKLQTVVDEMKLDDVKMKEKIKKYEGEKQQLEEALLSAREQEKEILSAKR
TLENQLEDIKKNLSQATQEQQHLSEKLQDETDQKEQLRRLKNEMENERWQLDKTIEKLHK
EMADIVEVSRTSTLELQNQLDEYKEKNRRELAEMQRQLKEKTMEAEKSRLTVIKMQDEMR
LMEEELQDYQRAQDEALTKRQLLEQTLKDVEYELETKSHLKEDRSRQVKQMEDKISQLEM
ELDEERNNSDLLSDRITRSREQIEQMRSELLQERAVRQDLECDKISLERQNKDLKSRMVH
LEGSYRSSKEGLVVQMEARISELEDRLENEERDRANLQLTNRRLERKVKELVMQVDDEHL
SLTDQKDQLSLRLKAMKRQVEEAEEEIDRLESSKKKLQRELEEQMDVNEQLQGQLNNMKK
NLRHKKMPSKVLDDLDDDDDDDDFSTDGGSLYEAPMGYPFSKENDPTKSASASHGV
Download sequence
Identical sequences F7E484
XP_001377867.1.35504 ENSMODP00000010397 ENSMODP00000010397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]