SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010430 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010430
Domain Number 1 Region: 260-437
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-42
Family Pentraxin (pentaxin) 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010430   Gene: ENSMODG00000008390   Transcript: ENSMODT00000010633
Sequence length 449
Comment pep:novel chromosome:BROADO5:6:63808168:63829454:1 gene:ENSMODG00000008390 transcript:ENSMODT00000010633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALLATGVVFLVVSGGGWGIGVRSQESQAPPGSRFVCTSLPLDATSAGCPFPSVPIQGG
ALTPEEELKATVLQLRETILQQKETIGNQRETIRELTGKLTRCESMAGGADGKSGPWRKE
YSKTGTGKDTMGDLPRDPGQVIDQLSRTMQSLKDRLEALEHQLRVNVSYAVLPNDFREML
QRRLGELERQLLSKVAELEDEKSLLHNETSAHRQKTETALNALLERVSELERGNSAFKSP
DAFKVSLPLRTNYLYGKIKKTLPELYAFTICLWLRSSASPGIGTPFSYAVSGQANEIVLI
EWGNNPIELLINDKVAQLPLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWH
PIKPGGVLILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLKAQEIMNIANCSTNMPGNI
IPWVDNNVDVFGGATKWPVETCEERLLDL
Download sequence
Identical sequences F7BVD5
ENSMODP00000010430 13616.ENSMODP00000010430 XP_001377910.1.35504 ENSMODP00000010430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]