SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010436 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010436
Domain Number 1 Region: 1-425
Classification Level Classification E-value
Superfamily Cytochrome P450 1.44e-114
Family Cytochrome P450 0.0000000000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010436   Gene: ENSMODG00000008394   Transcript: ENSMODT00000010639
Sequence length 425
Comment pep:novel chromosome:BROADO5:4:385179944:385194228:-1 gene:ENSMODG00000008394 transcript:ENSMODT00000010639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LREKYGDVFTIFLGSRPVVVLCGPDTVKEALVEKAEEFSGRGPIAMVDSVFQGLGVIFSN
GHTWKTLRRFSLATLRDFGMGKRSIEERIQDEAQCLVEELRKSKGEEIIQHHLLHCIWVK
RFSYHDDMFQELLNKFNETFVLTSSAWGQLFELFSGFLKFFPGPHRRSQSNLEFINAYIA
DNVEKHRQSLDPNAPRDFIDIYLLRMEKEKGISGTEFHHKNLILTVLSLFFAGTETTSTT
LRYGCLILLKYPGVAEKVQDEIDQVIGKDRTPEIKDRAKMPYTEAVIYEIQRFSDLLPLG
VPHCVTQDTSFRGYLIPKGTEVYPLLSTVLHDPKYFKKPYDFDPNHFLDAQGSLKKNEAF
IPFSSGKRICLGEGIARMELFLFLTTILQNFSLRSSMVPADIDLTPRESGVGNVPPTFQI
QFLPR
Download sequence
Identical sequences F7BVA3
ENSMODP00000010436 ENSMODP00000010436 13616.ENSMODP00000010436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]