SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010480 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000010480
Domain Number - Region: 54-106
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000824
Family TNF receptor-like 0.021
Further Details:      
 
Domain Number - Region: 127-161
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0647
Family TNF receptor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010480   Gene: ENSMODG00000008428   Transcript: ENSMODT00000010685
Sequence length 436
Comment pep:novel chromosome:BROADO5:4:293793501:293868271:1 gene:ENSMODG00000008428 transcript:ENSMODT00000010685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAWGESTSCAAEALEYSSSKEMESRSSPKELLFTIIFLLAHLPHRIMSETGDCRQQEFR
DRSGNCVPCKQCGPGMELSKECGFGYGEDAQCMTCRPHRFKEDWGFQKCKSCLDCALVNR
FQKANCSVTSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCTTKVNLVKIPS
TASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEKKPRWSMRSQDIQYNGSELSC
FDRPRLNDYPHRTCCQCHQDSAQTCGPVHLIPSLCCDETCSMDHGTHGCALHSRTTLHER
NASSVGEMLPTFFGSISHSTCGDLSDAWPLMQNPICSDTLSLSESYLELNGGERNSLNLE
TENSAILDSNSSQDLVGTVASLQSHPENLAETTEWCPQSLLTDPPLNQESLTSKNHLEQE
SEDTMNMVPQSSLEEA
Download sequence
Identical sequences F7AL23
ENSMODP00000010480 XP_007495280.1.35504 ENSMODP00000010480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]