SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010485 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010485
Domain Number 1 Region: 84-177
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 4.71e-29
Family MED7 hinge region 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010485   Gene: ENSMODG00000008431   Transcript: ENSMODT00000010690
Sequence length 244
Comment pep:novel chromosome:BROADO5:1:352063694:352224115:-1 gene:ENSMODG00000008431 transcript:ENSMODT00000010690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIERAEVLENFKMGEPQQVSALPPPPMQYIKEYTDENIRKGLAPKPPPPIKDSYMMFGNQ
FQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEK
LEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCL
ASLPDDLPHTEGGMRLKTEPMDTDDSKNCIGQNEQRENSSHRRDQIIEKDAALCILIDEM
NERP
Download sequence
Identical sequences F7AL10
ENSMODP00000010485 ENSMODP00000010485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]