SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010543 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010543
Domain Number 1 Region: 373-402,491-602
Classification Level Classification E-value
Superfamily TIMP-like 1.45e-33
Family Netrin-like domain (NTR/C345C module) 0.018
Further Details:      
 
Domain Number 2 Region: 284-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 3 Region: 403-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010543   Gene: ENSMODG00000008479   Transcript: ENSMODT00000010749
Sequence length 603
Comment pep:novel chromosome:BROADO5:2:251984478:252375706:1 gene:ENSMODG00000008479 transcript:ENSMODT00000010749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRRVWEALAALAAVACLVEAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNSAF
GKDVKVSSTCGRPPARYCVVVERGEERLRSCHLCNASDPKKAHPPTFLTDLNNPHNLTCW
QSENYLQFPHNVTLTLSLGKKFEVTYVSLQICSPEPESMAIQSMDYWRTWVPFQFYSTQC
RKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDW
VTATDIRVAFNRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDDS
LVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSG
RKSGGVCLNCRHNTAGRHCHYCKEGYYRDMNKPITHRKACKACDCHPVGAAGKTCNQTTG
QCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSIEEPEDCDSCARASKG
ERKIDMKKYVKKECAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRD
VACKCPKIKVLKKYLLLGNDEDSPDQNGIVADKTSLVIQWRDTWARRLRKFQQREKKGKC
KKA
Download sequence
Identical sequences F7G4D6
ENSMODP00000010543 13616.ENSMODP00000010543 ENSMODP00000010543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]