SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010550 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010550
Domain Number 1 Region: 53-526
Classification Level Classification E-value
Superfamily Cytochrome P450 2.1e-114
Family Cytochrome P450 0.000000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010550   Gene: ENSMODG00000008486   Transcript: ENSMODT00000010756
Sequence length 545
Comment pep:novel chromosome:BROADO5:1:663115286:663119014:1 gene:ENSMODG00000008486 transcript:ENSMODT00000010756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSRSSEETWLPGLLSTQQTTLLLLFSVLAVVHLGQWLLRRVRRTPWASCRPPGPFQWP
LIGNAVEVGSIPHLSFTRLARRYGDVFQIRLGNCPVVVLNGERAIRQALLQQGAAFASRP
PFASFQVVSNGRSLAFNKYSELWKVQRRVAHGTVRAFSTGQVRSRQVLEQHVLSETRELV
ELLVQGSAGGAFLNPGPLTVVAVANVMSAVCFGCRYSHSDEEFRELLSHNERFGRTVGAG
SLVDVLPWLQRFPNPVRTAFRDFQKLNQDFYSFVLDKFLKHKSSLQPGAPPRDMMDAFIH
TVGKEEENPGEVKPGLRLDTEYVPATVTDIFGASQDTLSTALQWLLILFIRYPKVQAQVQ
EELDRVVGRDRLPSLNDQPHLPYVMAFLYEAMRFSSFVPVTIPHATTIDTSVMGYHIPKD
TVVFINQWSVNHDPEKWQNPEDFNPARFLDKKGFIDKDLASGVMIFSMGKRRCIGEELSK
IQLFLFIAILAHQCNFLANPDEDPEMNFSYGLTIKPQSFTINVTLRESMELLDSTVQRLQ
EENNQ
Download sequence
Identical sequences F7G461
XP_001365629.2.35504 XP_007477081.1.35504 ENSMODP00000010550 ENSMODP00000010550 13616.ENSMODP00000010550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]