SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010552 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010552
Domain Number 1 Region: 71-370
Classification Level Classification E-value
Superfamily Release factor 3.66e-109
Family Release factor 0.000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010552   Gene: ENSMODG00000008487   Transcript: ENSMODT00000010758
Sequence length 384
Comment pep:novel chromosome:BROADO5:2:433162625:433172155:-1 gene:ENSMODG00000008487 transcript:ENSMODT00000010758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQSLLLLRSARCLWTRGALLRTPRRPASSGSPQLEELFSGGGAMRNFLERLTGPGVQAH
FGVKEPELAMAARKLREKEQELQEIERLLEDENEDLRKLAENEIISCQKELTKLKQKIIL
LLIPSEETDENDLILELTAGVGGQEAMLFTAEMFDMYQRYATYKKWHFEILEYFPSEIGG
LRHASASIGGPEAYRHMKFEGGVHRVQRVPKTEKQGRMHTSTMTVAILPQPTEINLVINP
KELRIETKRASGAGGQHVNTTDSAVRIVHLPTGVATECQQERSQIKNKEMAMKKLRAKLY
SMLLEEETNKRYSARKIQIGTKGRSEKIRTYHFPQNRVTDHRISKSLYDIQSFMLGEYLL
DELIQSLKEYADYESITEVISERC
Download sequence
Identical sequences F7G454
XP_007484837.1.35504 ENSMODP00000010552 ENSMODP00000010552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]