SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010574 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010574
Domain Number 1 Region: 20-300
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-66
Family Protein kinases, catalytic subunit 0.0000855
Further Details:      
 
Domain Number 2 Region: 613-701
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-24
Family DEATH domain, DD 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010574   Gene: ENSMODG00000008505   Transcript: ENSMODT00000010780
Sequence length 706
Comment pep:novel chromosome:BROADO5:3:343309951:343362280:-1 gene:ENSMODG00000008505 transcript:ENSMODT00000010780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKKELPFPEDCPSKQETDMSLDDMEMKTDDLLEKEQIDSGGFGMVSLCFHRNHGLVILK
NVYTGPKRTEYNAALLEEGKIMHRLKHNRVVKFLGFILEDGNYSLVMEYMEKGNLMKVLK
TTSIPLSVKGRSILEIIEGMCYLHGEGVIHKDLKPENILVDENFHIKIADLGVAFFKTWS
KLTKEENNRQRKINTAVKANAGTLLYMAPEHLNDVNAKPTDKSDVYSFAIVLWAIFANKE
PYENAICEQQIITCIGNGNRPNVEEIAGKCPKEIIDLMVRCWNGNPEDRPTFSEIDQEFR
PFYLKQLGEKVEEDVKSLKETYPSPNEVVKRMQSLQVDSVPVAPSRTNSEQPNSLHSSQE
LRTGSIDESMFAPYPENQPVENESSPEAQSLQSKLQEEANYHLYGSRMDKRTNSQFKNAA
EKREEERRRRVSHDPYAAGPAPRTTSPFYPNTFLSGKGYHLPDANSHNNLSQRPAEPSTP
LPVLNNHPVFGSRPMDSRTNNVLGLNPSGVSTPFKIPVPESNTGASMPTLPFDAIGQVNS
MSTMMKNFSFVPQIPVSLPGFEGSVPCKIINSSGIQFGNNNYMVIDDSSLMARNIPTNIQ
QESESKYQHIFEDTTGVLDKHLDPVRENLGKNWKKCARRLGFTESQIDEIDHDYDRDGLK
EKVFQMLQKWLMREGNKGATVGKLAKALFQCQRIDLVNILIFVNQN
Download sequence
Identical sequences F7FTF3
ENSMODP00000010574 XP_007488097.1.35504 XP_007488098.1.35504 XP_007488099.1.35504 XP_007488100.1.35504 XP_016287283.1.35504 XP_016287284.1.35504 XP_016287285.1.35504 XP_016287286.1.35504 XP_016287287.1.35504 XP_016287288.1.35504 XP_016287289.1.35504 XP_016287292.1.35504 ENSMODP00000010574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]