SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010610 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010610
Domain Number 1 Region: 298-603
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.12e-76
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 71-183
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-31
Family Spermadhesin, CUB domain 0.0000179
Further Details:      
 
Domain Number 3 Region: 254-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.00036
Further Details:      
 
Domain Number 4 Region: 188-257
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000514
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 21-69
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.00097
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010610
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0987
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010610   Gene: ENSMODG00000008535   Transcript: ENSMODT00000010817
Sequence length 617
Comment pep:novel chromosome:BROADO5:7:253188835:253228620:1 gene:ENSMODG00000008535 transcript:ENSMODT00000010817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTFRSDFSNEERFTGFDAHYMAVDVDECTEKSDEELACDHYCHNYIGGYYCSCRIGYI
LHTDNRTCRVECSDNLFTQRTGVITSPDFPGPYPKSSDCLYRIELEDGFLITLQFEDSFD
VEDHPEVSCPYDYIKIKAGQKEFGPYCGEKSPARIVTQSNSVQILFHSDNSGENGGWRLS
YSSSGNPCPALQPPIRGKIDPAQAQYTFRDQVLISCAAGYKVVKDNLELDTFQIECLKDG
TWSNRVPACKIVDCGTPKELEHGQVTFATKSNLTLYKSEVHYSCQQPYYQLFPNITGTYA
CEAQGTWMNGELGEKLPTCLPVCGQPSHSLPALVKRIIGGRNAEPGFFPWQALIVVEDTS
RVPNDKWFGSGALLSESWVLTAAHVLRSQRRDNTVIPVSREHVTVYLGLHDVRDKSGAVN
RTAARVILHPDFDIQNYNHDIALVQLKEPVPLGPHVLPVCLPAPEPEGPLPNTLGLVAGW
GISNPNVTVDEIIGGGMRTLSDVLQYVKLPVVLHAECKASYESRSGNYSVTENMFCAGYY
EGGKDTCLGDSGGAFVIQDAPSRRWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVRWLWS
QLGSPGGRGEVEAEAER
Download sequence
Identical sequences F7DHC5
XP_016280817.1.35504 ENSMODP00000010610 ENSMODP00000010610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]