SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010654 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010654
Domain Number 1 Region: 263-541
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.11e-102
Family Myotubularin-like phosphatases 0.000000746
Further Details:      
 
Domain Number 2 Region: 122-252
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.12e-36
Family Myotubularin-like phosphatases 0.0000646
Further Details:      
 
Domain Number 3 Region: 6-112
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-17
Family GRAM domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010654
Domain Number - Region: 534-578
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0942
Family MED7 hinge region 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010654   Gene: ENSMODG00000008567   Transcript: ENSMODT00000010862
Sequence length 660
Comment pep:novel chromosome:BROADO5:4:294853205:294919862:-1 gene:ENSMODG00000008567 transcript:ENSMODT00000010862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSLQKETWILHHHIAAVEKLA
LTTSGCPLVIQCKNFRIVHFIVPRERDCHDIYNSLLQLSRQAKYEDLYAFSYNPKQNESE
RVQGWQLIDLTEEYRRMGIPSLSWQLSDANRDYKICETYPRDLYVPKTANKPIIVGSSKF
RSKGRFPVLSYYHQDKEAAICRCSQPLSGFSARCLEDEHMLQAISKANPSNRYMYVMDTR
PKPRMQSWWASKKDIGRIVVRISSKIWRDEKIRESDEKARLNAMANRAAGKGYENEDNYS
NIRFQFVGIENIHVMRSSLQKLLEVNGTRALSVNDFFSGLESSGWLRHIKAVLDAAVFLA
KAIVVESASVLVHCSDGWDRTSQVCSLGALLLDSYYRTIKGFMVLIEKDWISFGHKFSDR
CGHLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEYNEVFLLQIHEHVHSCQFGNFLGNCQ
KEREDLKLKEKTYSLWPFLLDDQEKYLNPLYCPSSQKFTVLEPNTVPFNFKFWRNMYHQF
DRTMHPRQSVFKLIMNMNDQNKQLEKEIKELESKIKHQKNRQTDTVLNKESLRSIHSDSP
ALKPSLCFKKEQTLLPGNDAIRTIEGSNTADNRYSEYAEEFSKTEPAVVSLEYGVARMTC
Download sequence
Identical sequences F7CX78
XP_007495293.1.35504 ENSMODP00000010654 ENSMODP00000010654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]