SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010686 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010686
Domain Number 1 Region: 122-304
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-31
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 332-510
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000019
Family Nucleotide and nucleoside kinases 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010686   Gene: ENSMODG00000008592   Transcript: ENSMODT00000010898
Sequence length 783
Comment pep:novel chromosome:BROADO5:4:385327806:385359696:1 gene:ENSMODG00000008592 transcript:ENSMODT00000010898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDANEYFSDVTGNTAEQNQYYETTNVHQEKKTGYESKPPELELEQQLTSYPVEGKPGIKK
EDSFASFPTSNPSQPHLSNRHHYQGRKRPFEDSRGRGYYEHREEKRGRSPQPPAEEDEEE
FDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINE
EISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEAFSYGYGGTGKKSTNSRFENYGDTFAE
NDVIGCFADFECGHEIELSFTKNGKWLGIAYRIQKDALGGQALYPHVLVKNCAVEFNFGQ
RREPYCSVIPGFTFIQHVPVGERIRGTIGPKSKADCEILMMVGLPAAGKTTWAVKHAAAN
PTKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILD
QTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIRRTDEEGKDVPDHAVLEMKANF
TLPSVGDFLDEVLFIELQREEADKLVKQYNEEGRKAGPPPEKRFDNRGVSNSGGFRGRGG
TGGFQRYDSRGPPGGNRGGFQNRGGSSGGGSGNSGGGGGGGGGGGGSYRGGFNRGGGGSN
NSGGGYPQSRWGSNNRDNNSNNRGGYTRAPQPQSYPPARSQPPPSSGVGGGSSSTYKSSN
IPTSGASSIGSTPPVSSYSPPQPTYTPTYNQGGYTQPAYTAPPPPPPPPPPTYNYGSYTA
YTPTYTTPPPPPTGQTYNQQNYNQYQQYAQQWNQYYQGQWPPYYGNYDYGSYSGNTQGGS
STQ
Download sequence
Identical sequences F7BUF5
ENSMODP00000010686 XP_007492005.1.35504 ENSMODP00000010686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]