SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010705 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010705
Domain Number 1 Region: 334-512
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-69
Family SPRY domain 0.00000881
Further Details:      
 
Domain Number 2 Region: 49-161
Classification Level Classification E-value
Superfamily Immunoglobulin 7.79e-21
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Domain Number 3 Region: 178-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000452
Family C1 set domains (antibody constant domain-like) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010705   Gene: ENSMODG00000008595   Transcript: ENSMODT00000010917
Sequence length 534
Comment pep:novel chromosome:BROADO5:2:251513829:251562302:1 gene:ENSMODG00000008595 transcript:ENSMODT00000010917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCLRAPKLSPNTPAPKIMNMAYFPDHSVLSGLVAVLFLQLLTMISAQFTVVAPAKPLLV
MVGEDAILHCHLFPKKNAEQMEVRWFRSQFSPAIYVYKDGKNRDEEQMEEYRSRTTFMRD
NIKDGSVALKIHNVTAFENGRYHCYFQEGRSYDEAFIDLKVASMGSDPLIEITGYEYGWI
QLECTSAGWYPQPRVEWRNLSEETIPSLEENLVPSEDGLFIVKLSVNITDHTVVSVFCSI
QNSLLSQELLAMMSIPGHPSEIPDLITTPSPEEVSTWMVALTVALPALGLFIACSICFTC
KQHKRKKTLFIEKEIECEEKDEKGQEQMDHLTGWRRIQLHAADVTLDQNTAHPELYLSQD
LRSVIRGDTRQDLPDNPERFDCRPCVLGCESFTSGRHYWEVEVADVMVWALGVCRENSER
KGEALLIPQNGFWVIELFGNRYQALTSPDILLPLSDHLYRVGIFLDYEAGDVSFYNMIDR
SHIYTCPRTSFSGPLRPFFRLGSDDNPLVICPAFTGAEGVTVPESGLILYRRPY
Download sequence
Identical sequences F6PHC4
ENSMODP00000010705 ENSMODP00000010705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]