SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010761 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010761
Domain Number 1 Region: 882-991
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000011
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 2 Region: 678-817
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000004
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 3 Region: 988-1115
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000502
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 4 Region: 599-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000233
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 5 Region: 846-900
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000171
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 6 Region: 804-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000796
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010761
Domain Number - Region: 440-546,598-641
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0173
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010761   Gene: ENSMODG00000008647   Transcript: ENSMODT00000010974
Sequence length 1226
Comment pep:novel chromosome:BROADO5:6:255779058:255957466:1 gene:ENSMODG00000008647 transcript:ENSMODT00000010974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKDCTGVDCKPLENCIEEVLEPGECCASCLKHGCTCEGYQYYDCVNVGFMNGKVPEGQSY
FVDFGSTECSCPKGGGKISCQFMLCPDLPPNCIDAVIPTDGCPQCGRIGCLQEGEKYVAG
HTVRMSHCKVCHCPNSGGELICYQLPDCDASAFHPSGNLSEHEENDPERHYDDPYSYDQE
ASEGDAAQVEPPTKGWTVPVAQPAPDPNSHEQLEQQEEDTNTIPASNTTLPGLTQLISPT
RQAAAVAVDPKVPGQSRTRSVMEQQETGIIKEPEEEEEEEEEMEVNEKATRAGSIHEKPE
ERQNSNNAVESEERVQERAEERGRAEPEGNTIPNAQPNPRDRGRDGERGASIGFQEVTPT
ERNVPQPGQGSQVEKTVPKVKFTPSTLPPVALQEDPTEETPKQSQTLYHYPPQEKIDPNS
IHSDPRGQEGSTKDLIETCCAAGQQWAIDNAECTEIPVSGADGDVCRIAQKQCCISYLKE
NSCVAGMVGAKEGEACGPEENDTCGISLYKQCCDCCVLGLRVKNEGQMCESNPNLGYPCN
HVMLSCCEGEDHLIVPEVRKPPEPLPTVTPEKVSERENLHEALSISQESELSNSLPGDDR
DECLLYPGELCQHLCINTVGSYKCACFPRFTLQEDGLSCHPDSEVMKPSTRGEGPLVPEA
PHSQPEIIRLPQPVPNTCKDNGPCKQVCNVIENRAMCSCFPGYAIMADGVSCEDMDECLR
GAHDCTRRQFCVNTLGSFYCVNHTVICAEGFILNMHRKCVDINECVTDTHTCSRGEHCVN
TVGSFHCYKDLNCESGYELKEGECVDIDECAQGIHSCKVNFVCQNTQGSFYCESKQRCMD
GFLQDPEGNCVDINECTSLPEPCKPGFNCINTVGSYTCQRNQLLCTRGYHSSEDGSKCVD
VDECETGVHRCGEGQVCHNLPGTYRCDCKMGYQYDAFSRACVDVNECWSYPGRLCQHACE
NTPGSYRCSCSSGFQLAFDGKHCEDVNECENNPCSQECANVYGSYQCYCRQGYQLAEDGH
ACKDIDECTQSAGILCTFRCVNVPGSYQCACPEQGYTMMANGRTCRDLDECTLGTHNCSA
AESCYNIQGGFRCLLFECPPNYRKVSDMRCERTSCFNFLDCQSTPVRITYYQLNFQTNIV
VPAHIFRIGPSPAYTGDNIILTITKGNEENYFSAQKLNPYTGVVYIQRPVKEPQDFLLDV
EMKLWRQGTYTTFLAKIYIFITAHAF
Download sequence
Identical sequences F6PGB2
13616.ENSMODP00000010761 ENSMODP00000010761 ENSMODP00000010761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]