SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010799 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010799
Domain Number 1 Region: 358-487
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.14e-24
Family Canonical RBD 0.00000578
Further Details:      
 
Domain Number 2 Region: 519-558
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000000000596
Family Ran binding protein zinc finger-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010799   Gene: ENSMODG00000008679   Transcript: ENSMODT00000011012
Sequence length 664
Comment pep:novel chromosome:BROADO5:3:517836467:517865045:1 gene:ENSMODG00000008679 transcript:ENSMODT00000011012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTDYSTYSQAAAQQGYSAYAAQPAQGYAQTTQAYGQQSYGAYGQPTDVSYTQAQTTAT
YGQTAYATSYGQPPTVEGAGTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAA
QSAYGTQPAYPTYGQQPATAAPARPQDGSKPAETSQPQSSTAGYSQPSLGYGQSNYSYPQ
VPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQQSSYGQQSSYGQQSSYGQ
QPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSAFRQDHPSSMGVYGQESGGFSGPGENRSM
SGPDNRGRGRGGFDRGGMSRGGRGGGGGGRGGMGAGERGGFNKPGGPMEEGPDLDLGSPV
DPDEDSENSAIYVQGLNESVTADELADFFKQCGVVKMNKRTGQPMINIYLDKETGKPKGD
ATVSYDDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGMPPREGRGMPPPLRG
GPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQ
NFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGR
GGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERR
DRPY
Download sequence
Identical sequences F6PFT3
ENSMODP00000010799 ENSMODP00000010799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]