SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010837 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010837
Domain Number 1 Region: 40-500
Classification Level Classification E-value
Superfamily Cytochrome P450 1.14e-115
Family Cytochrome P450 0.0000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010837   Gene: ENSMODG00000008705   Transcript: ENSMODT00000011050
Sequence length 501
Comment pep:novel chromosome:BROADO5:6:69227423:69273881:1 gene:ENSMODG00000008705 transcript:ENSMODT00000011050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFLPSVPADPIVIALLGLLLSWALFCLLTRSKERAGKWPPGPAPLPFIGNLHLLDLRRQ
DKSLMKISEKYGPVFTIHFGLQKMVVLTGYHAVKEALVDSAEEFADRPPIPIFQRIQEGQ
GIFFSSGNLWKTTRKFTMSSMHKLGMGKKLIAKKILEEFSFLEELIDSFKGEIFDCEPFK
LKLFNMAPTNVIFFLLFGERFDYQDPTFVTFIRLIDEVMVLLGSPFLHLFNFYPFLGWFL
KPHKTVLVKIEEVRVILRKYMVASRQNISRGYVTSYIDALIQKQSEEPKEDTISQMKTLL
PPSLTLVMAGTETTATSLQWAILLMAQIPRAKVQDELDRVLEKSRLPEYEDQKALPYTNA
VVHEIQRFIALLPHVPHSTSVDTHFRGYFIPKGTPVIPLLTSVLLDKTQWETPNKFNPSH
FLDADGNFVKKAAFLPFSIGHRVCIGENLAKMEMFLFFASLLQRFTFHPPPGIQEADLDI
TPQLTFTMRPQPQAVCAVSRS
Download sequence
Identical sequences F6PWJ8
ENSMODP00000010837 ENSMODP00000010837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]