SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010893 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010893
Domain Number 1 Region: 855-937
Classification Level Classification E-value
Superfamily DEATH domain 3.57e-22
Family DEATH domain, DD 0.00000943
Further Details:      
 
Domain Number 2 Region: 162-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000444
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 252-303
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000101
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 4 Region: 306-359
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.00077
Further Details:      
 
Domain Number 5 Region: 55-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000109
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010893   Gene: ENSMODG00000008754   Transcript: ENSMODT00000011109
Sequence length 945
Comment pep:novel chromosome:BROADO5:1:25390228:25548221:1 gene:ENSMODG00000008754 transcript:ENSMODT00000011109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARSAAAATAAPTAQGARLLVLLLLWNLRLCGAGIEYGEILPDSFPSAPAEPLPHFLQE
PQDAYIVKNKPVELLCRANPATQIYFKCNGEWVNQNDHLTKESLDEVTGLLVREVQIEVS
RQQVEELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLEHEVLLQ
CRPPEGVPIAEVEWLKNEDVIDPTQDTNYLLTIDHNLIIRQARLSDTANYTCVAKNIVAK
RRSTTATVIVYVNGGWSTWSEWSPCNNRCGRGWQKRTRTCTNPAPLNGGAFCDGQAFQKV
ACTTMCPVDGAWTEWSKWSACSTECTHWRSRECTPPPQNGGRDCSGLLLDSKNCTDGLCT
QNKRVLTEPKSHLMEATGDVALYAGLVVAIFVFIVILMAVGVVVYRRNCRDFDTDITDSS
AALTGGFHPVNFKTARHSKEKERGREGMANPWREQKAQHGRREAGYWSMLVEGVPIPGTP
YIDKIKTRLKKNYHSKIDKMGRQGILCSCLCILQLLAQPPIYASERQYGKTLEARNIIPL
YMPLRDSMEKPWRQGILCSCLCILQLLAQPPIYASERQYGKTLEARNIMFLLPAEGTQTV
LSPMVTCGPTGLLLCRPVILTVPHCAEVSSSDWIFQLKTQSHQGNWEEVVTLDEETLNTP
CYCQLETKSCHILLDQLGTYVFMGESYSRSAIKRLQLAIFAPALCTSLEYSLRVYCLEDT
PDALKEVLELEKTLGGYLLEEPKPLLFKDSYHNLRLSIHDIPHALWRSKLLAKYQEIPFY
HIWSGSQKALHCTFTLERYSLASTELTCKICVRQVEGEGQIFQLHTTLAETAAGSLENFC
SAPSSSVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKA
SPTGVILDLWESLHQDDGDLNTLASALEEMGKSEMLVVMATDGDC
Download sequence
Identical sequences F6PRR4
ENSMODP00000010893 ENSMODP00000010893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]