SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010899 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010899
Domain Number 1 Region: 386-462
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.53e-20
Family Intermediate filament protein, coiled coil region 0.00051
Further Details:      
 
Domain Number 2 Region: 153-187
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000204
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 200-264
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000575
Family Intermediate filament protein, coiled coil region 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010899
Domain Number - Region: 320-387
Classification Level Classification E-value
Superfamily Prefoldin 0.000471
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010899   Gene: ENSMODG00000008758   Transcript: ENSMODT00000011115
Sequence length 549
Comment pep:novel chromosome:BROADO5:8:34462640:34479247:-1 gene:ENSMODG00000008758 transcript:ENSMODT00000011115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSSFSSVFMKASMSRQAYSTKGGFSSSSASGGHGMGGTQTHTSFSSMTMSRGGSRLGGA
AYCSPRGSFGSHSHHNLGANTRISVSMAQGASHGRSFGGFGVGAGSYLGLGSSRPNFGAS
CPPGGIQEVTVNQSLLTPLNVEIDPEIQRVRTQEREQIKTLNNKFASFIDKVRFLEQQNK
VLETKWALLQEQSQNTVATKDLEPYFETYICNLRRQLDALQNEAGRLDLELNNIHDHVDN
QKHSYEEEFNKRTVAENEFVTLKKDVDAEYMNCANLEAISKSMLEEFNFLQNLFAMERSQ
FQTHVSDTNVVLSMDNNRCLDLDSIIAEVKTQYEEIAKRSRAEAESWYQTKYEELQVTAG
KHEDHLRDTKKEISELTRTVQRLQGEIDSVKKQCQQLQTAIADAEQCGELAIKDAKKKLG
DMETALHHTKEELAKLLRDYQELMNVKLALDMEIATYKKLLECEESRMSGECPSAISISV
MGNSTSMCGGNIRGVGSSRAGVSLGSSCGGMKGSYGSSCSYAKPGPNTGGTSILKKTTST
TVKSSTRRY
Download sequence
Identical sequences F6PRL3
ENSMODP00000010899 ENSMODP00000010899 13616.ENSMODP00000010899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]