SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010913 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010913
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily PCD-like 5.62e-20
Family PCD-like 0.0000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010913   Gene: ENSMODG00000008769   Transcript: ENSMODT00000011129
Sequence length 55
Comment pep:novel chromosome:BROADO5:1:24784041:24879795:-1 gene:ENSMODG00000008769 transcript:ENSMODT00000011129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSLA
Download sequence
Identical sequences F6RGQ4
ENSMODP00000010913 ENSMODP00000010913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]