SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010951 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010951
Domain Number 1 Region: 23-464
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.28e-117
Family L-arabinose binding protein-like 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010951
Domain Number - Region: 472-519
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0361
Family TNF receptor-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010951   Gene: ENSMODG00000008773   Transcript: ENSMODT00000011167
Sequence length 820
Comment pep:known chromosome:BROADO5:3:522485988:522507057:1 gene:ENSMODG00000008773 transcript:ENSMODT00000011167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHECLLIESNKLSLKSLSLVFHSLSLRLMHKNYQQVLALVFAVEEINSDPNLLPNISSL
GFHLYNAYHSDSRTLESSLRWLSGQGQLVPNYSCSGQDKSVAVIGGATSALSVQMGTLLE
LYKFPQISYGPFDSILSNKAHFPSVFQMSQRDSSLFDGIVRLIAYFEWTWIGLVTTDDMR
GEQFLWDLRGDMVKHGICLAYTEKIPVSERRHTESQDMFMQRILRSSVSVIIVHGDTDSL
MILRYSQPVFLFLWKVWITTSHWDITMRPHWDDGYSFHGALSFSQMTKEIPGFKPFLRTV
NPAKYPEDTVLKKFWCSAFKDQEKLENQVQNECSPNASLETLPLRFFDMTMSGLSYTIYN
AVHTVARALHEMLLSVARFVSQGKAVTNISFPFQLHPFLKNTCFNNSAGDQVLLDATGSS
AAGYNILKYLFFQNGTETLVKVGQFIPGAPLGQDFTISKEVIVWDSFESKIIHAVCSNSC
APGFRKAQREGEPICCFDCSLCPEGEISSQINMKHCMKCPEDEYPNKERDRCLPKAITFL
DIKEPLGMTLACVALFFSVLTALILGVFVKFRNSPIVKANNRTLSYTLLISLTLCFLCSL
LFIGYPTAATCLLRQTTFGLVFTVAVSSILAKTILVVLAFRVTKPGRRSKRWLQPGVSNC
IVVLCSGIQVILCGIWLGISPPFPDTDRYSQSNQIIIECNEGSVLGFYCVLGYMGFLALG
SFMVAFLARGLPDTFNEAKFITFSMLVFCSVWVSFLPTYQSTKGKAMVVVEIFSILASSA
GLLCFIFIPKCYVILLRPNGNTQECIRNVRVQEGKALCVR
Download sequence
Identical sequences F6QUZ8
ENSMODP00000010951 ENSMODP00000010951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]