SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011028 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011028
Domain Number 1 Region: 25-499
Classification Level Classification E-value
Superfamily Cytochrome P450 1.57e-65
Family Cytochrome P450 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011028   Gene: ENSMODG00000008855   Transcript: ENSMODT00000011245
Sequence length 504
Comment pep:known chromosome:BROADO5:3:181238213:181250227:1 gene:ENSMODG00000008855 transcript:ENSMODT00000011245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTISLIWGIVVAICCCLWLITGIRRRRMGEPPLENGLIPYVGCALQFGANPLEFLRINK
RKYGHIFTCKLMGKYVHFITNPFSYTTVMRHGKYFDSKKFNLAASAKAFGHRSIDPSDGN
TTENVHETFIRTLQGDALNSLSEAMMENLQYVMRPPGLSKTNPDSWVTEGMYSFCNKVMF
EAGYLTLFGKDLTRQEAQRTSILNNLDNFKQFDKIFPALVAGLPIHVFKNAHNAREKLAE
DLKHENLQKRDNISELITTRMFLNDTLSTFDDMEKAKTHLALLWAAQANTLPATFWCLFH
TIRSSEAMKMATEEVRKTLEKSGQKISFEGKPISLSQMQLNDMPVLDSIIKEALRLSSAS
LNIRPAKEDFTLHLEEGSYNIRKDDIIAIYPQLLHLDPEIYPDPLTFKYDRYLDENGKPK
NSFYCNGIKLKYYYMPFGWGLTMCPGRLFAVSEIKQFLILMLSYFEMQLVDSQVKCPPLD
QSRVGLGILPPTNDIEFKYRLKYL
Download sequence
Identical sequences F7CUJ1
13616.ENSMODP00000011028 XP_001368424.1.35504 ENSMODP00000011028 ENSMODP00000011028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]