SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011057 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011057
Domain Number 1 Region: 444-762
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.46e-82
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000000115
Further Details:      
 
Domain Number 2 Region: 766-869
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.04e-28
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000785
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011057   Gene: ENSMODG00000008871   Transcript: ENSMODT00000011274
Sequence length 880
Comment pep:novel chromosome:BROADO5:Un:62342610:62363396:1 gene:ENSMODG00000008871 transcript:ENSMODT00000011274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGHQFCPENLKKLILSETTIFDVLPTFFYHANQVVCMASLEVYVRRGYIAYELNSLQHR
QLPDGTCVVEFQFMLPSSHPNRMALPVSVTNPDLLRHSTELFMDSGFSPLCQRMGAMVAF
HRFEDFVRNFDEVISCFANLAKESPLFSEARSMMYSEEDCKCIKDEPIHILNVAVQCADH
LEDDELVPVFRTFVQSKKHVLVEYGLRRITFLIAQEREFPKFFTFRARDEFAEDRIYRHL
EPALAFQLELNRMRNFELKAVPCANHKMHLYLGAARVKEGTEVTDHRFFIRAIIRHSDLI
TKEASFEYLQNEGERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPSKIEESVR
SMVMRYGSRLWKLRVLQAEVKINIRMTPTGTAIPIRLFLTNESGYYLDISLYKEVTDPRS
GNIMFHSFGNKQGAQHGMLINTPYVTKDLLQAKRFQAQSLGTTYIYDFPEIFGEALYKLW
GSEKHPKDVLTCTELVLDSQGQLVEMNRLPGGNEIGMVAFKMVLKTREYPQGRTIIVIGN
DITFRIGSFGQEEDLLFLRVSQLARAEGIPKIYLSANSGARIGLAEEIRHMFQVAWLDPA
DPCKGFKYLYLTPQDYTKISSLNSVHCTHIEEEGESRYVITDIIGKDDGLGVENLRGSGT
IAGESSLAYEEIITVSMVTCRAIGIGAYLVRLGQRVIQVDNSHIILTGAGALNKVLGREV
YTSNNQLGGVQIMHFNGISHITVPDDFEGVYTILEWLSYMPKDNYSPVPIITPTDPIDRE
IEFLPSKAPYDPRWMLAGRPHPTVKGTWQSGFFDQNSFKEIMEPWAQTVVTGRARLGGIP
VGVIAVETRTVEMVVPADPANLDSEAKVSVEGRRESSGRA
Download sequence
Identical sequences H9H6A8
ENSMODP00000011057 ENSMODP00000011057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]