SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011098 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011098
Domain Number 1 Region: 19-46
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000108
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011098   Gene: ENSMODG00000008906   Transcript: ENSMODT00000011315
Sequence length 180
Comment pep:novel chromosome:BROADO5:8:63132830:63223539:1 gene:ENSMODG00000008906 transcript:ENSMODT00000011315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLV
AQQVTQQFVPPPQSKKEKKDKLEKEKSEKETTSKKNSYKKTRPRLKNVDRSSAQHLEVTV
GDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH
Download sequence
Identical sequences F7B493
XP_001362223.1.35504 ENSMODP00000011098 ENSMODP00000011098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]