SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011253 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011253
Domain Number 1 Region: 154-301
Classification Level Classification E-value
Superfamily EF-hand 2.04e-52
Family Osteonectin 0.000000108
Further Details:      
 
Domain Number 2 Region: 95-150
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000152
Family Ovomucoid domain III-like 0.0000361
Further Details:      
 
Domain Number 3 Region: 70-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family Follistatin (FS) module N-terminal domain, FS-N 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011253   Gene: ENSMODG00000009028   Transcript: ENSMODT00000011471
Sequence length 303
Comment pep:novel chromosome:BROADO5:1:345727222:345752516:-1 gene:ENSMODG00000009028 transcript:ENSMODT00000011471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWIFFLLCLAGRALAAPQQQEALPDEAEVVEEPVAEVTEEPVGANPVQVEVGEFDEPA
EETEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPVGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELSEFPLRMRDWLKNVLVTLYE
RDEDNNLLTEKQKLKVKKIHENEKRLEAGDHPVELLARDFEKNYQMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFEACDLDNDKYIALDEWAGCFGIKDQDIDKD
LVI
Download sequence
Identical sequences F7B2X8
13616.ENSMODP00000011253 ENSMODP00000011253 XP_001369504.1.35504 ENSMODP00000011253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]