SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011339 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011339
Domain Number 1 Region: 163-465
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.54e-42
Family Protein kinases, catalytic subunit 0.0019
Further Details:      
 
Domain Number 2 Region: 12-119
Classification Level Classification E-value
Superfamily DEATH domain 8.54e-28
Family DEATH domain, DD 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011339   Gene: ENSMODG00000009096   Transcript: ENSMODT00000011559
Sequence length 616
Comment pep:novel chromosome:BROADO5:8:32310544:32409148:-1 gene:ENSMODG00000009096 transcript:ENSMODT00000011559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWAPVDGRSSPWEPAAFPASLPLFDLPPSLLGAFCSILDSCDGVLGWRGLAERISSSWL
EVRHIEKYMEQGKSGTRELLWSWAQKNKTIGDLLQILQEMGHERAINLIVNHGRTISAST
KQSQQSAGFPNIPSQVPTDSTIDKQGEMPEYRKEIRLKPSFNFKSIIEGTKNFHKDLLIG
EGEFFKVFRVELQNGTYAVKLFKQETTIQNKKNWKMFFSELEVLNLKSTHHPLYRETSYY
HISVPSFCSLFQLPPQISLYKKLENVGDDNTFPLSWQLRLSILIGAAKAIQYLHHVEPCS
VICGNITSSNILLDSQFQPKLTNFVTAHLRPHLEKQSSTINMESSRNKYLLYMPEEYIRQ
RRLSIKTDVYSFGIVIMEVLTGYQVVLEGPKYVRLRDLLVELMEKRGLESCLSLLDKKIS
PCPQNFSWKLFTLANQCASSRAKLRPTMDEVLVALESSCPNLHFTEDPPKSLKSFRSPSP
LFLNHLPSVPMENDENQDFCSLPNENLDKDGFAQKTPLECSQSEVTFLGLDRKALGKGKT
PVSEVPVSSWEDNFSSNHLHPSQDSSVCVMNMYLSSESGNPVLSKLVEPSSSSESYRNKN
EEMEKMTSENILQSDF
Download sequence
Identical sequences F7FQL3
ENSMODP00000011339 ENSMODP00000011339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]